Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

37 sentences found for "know-how"

1. "Dogs are better than human beings because they know but do not tell."

2. "The better I get to know men, the more I find myself loving dogs."

3. D'you know what time it might be?

4. Don't beat around the bush with me. I know what you're trying to say.

5. Excuse me, may I know your name please?

6. Hi, we haven't been properly introduced. May I know your name?

7. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

8. I always wake up early to study because I know the early bird gets the worm.

9. I didn't want my sister to know about the family vacation, but my mom let the cat out of the bag by accident.

10. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

11. I don't think we've met before. May I know your name?

12. I don't want to beat around the bush. I need to know the truth.

13. I know I should have apologized sooner, but better late than never, right?

14. I know I should have gone to the dentist sooner, but better late than never.

15. I know I should have started studying earlier, but better late than never, right?

16. I know I'm late, but better late than never, right?

17. I know they're offering free samples, but there's no such thing as a free lunch.

18. I know things are difficult right now, but hang in there - it will get better.

19. I know this project is difficult, but we have to keep working hard - no pain, no gain.

20. I know we're behind schedule, but let's not cut corners on safety.

21. I know you're going through a tough time, but just hang in there - you're not alone.

22. I'm sorry, I didn't see your name tag. May I know your name?

23. It takes one to know one

24. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

25. May I know your name for networking purposes?

26. May I know your name for our records?

27. May I know your name so I can properly address you?

28. May I know your name so we can start off on the right foot?

29. Ngumiti lang sya, I know everything, Reah Rodriguez.

30. Pardon me, but I don't think we've been introduced. May I know your name?

31. Sayang, kamu tahu betapa bahagianya aku bersama kamu. (Darling, you know how happy I am with you.)

32. Some people argue that it's better not to know about certain things, since ignorance is bliss.

33. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

34. Sorry, I didn't catch your name. May I know it again?

35. Though I know not what you are

36. We all know that he's struggling with addiction, but nobody wants to talk about the elephant in the room.

37. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Ang Datu ay nalungkot at nawalan ng lakas na harapin ang katotohanan.

2. Hindi dapat tayo magpaplastikan dahil mas makakabuti kung magiging totoo tayo sa isa't isa.

3. El agua potable es fundamental para mantenernos hidratados y saludables.

4. Nag re-review si Gina para sa darating na board exam.

5. Mon mari et moi sommes mariés depuis 10 ans.

6. May isinulat na sanaysay ang isang mag-aaral ukol kay Gabriela Silang.

7. Hindi dapat tayo gumamit ng marahas na wika sa mga pag-uusap.

8. Tantangan hidup dapat muncul dalam berbagai bentuk, baik dalam bidang pribadi, profesional, atau emosional.

9. They do not litter in public places.

10. Nasaktan, nagalit din ang lola at gumanti.

11. I used a traffic app to find the fastest route and avoid congestion.

12. Confocal microscopes use laser technology to create 3D images of small structures.

13. Ang talambuhay ni Leandro Locsin ay nagpapakita ng kanyang husay at kontribusyon sa arkitektura ng Pilipinas.

14. Mobiltelefoner, tablets og computere er eksempler på elektronik, som mange bruger hver dag.

15. Television has a long history, with the first television broadcasts dating back to the 1920s

16. Mura lang ang mga damit sa Greenhills.

17. Bagkus sa pag-ulan, ang panahon ay mainit at maalinsangan.

18. Bumili ako ng sarong. Ikaw, saan ka nagpunta?

19. Kumain siya at umalis sa bahay.

20. Tinanggal ko na yung maskara ko at kinausap sya.

21. La foto en Instagram está llamando la atención de muchos seguidores.

22. Naibaba niya ang nakataas na kamay.

23. Magkano ang bili mo sa iyong cellphone?

24. Biglaan kaming nag-decide na magbakasyon sa beach ngayong weekend.

25. Da Vinci murió en Francia en el año 1519.

26. Gracias por su ayuda.

27. Yeah. masayang sabi ni Chad with matching thumbs up.

28. Nasa harap ako ng istasyon ng tren.

29. La música es un lenguaje universal que puede ser entendido por personas de diferentes culturas y lenguas.

30. Si Jose ay na-suway sa simpleng paalala na huwag mangulangot sa harap ng ibang tao.

31. Dumating ang mga atleta sa entablado nang limahan.

32. Maria, si Ginang Cruz. Guro ko siya.

33. International cooperation is necessary for addressing global environmental challenges, such as climate change.

34. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

35. A wedding planner can help the couple plan and organize their wedding.

36. Kukuha lang ako ng first aid kit para jan sa sugat mo.

37.

38. Napakabilis ng wifi sa kanilang bahay.

39. La tos puede ser un síntoma de neumonía.

40. Mga prutas ang tinitinda ng tindera.

41. Ahhh...wala! Bakit ba, nagdadasal ako noh!

42. Ayaw na rin niyang ayusin ang kaniyang sarili.

43. Ang pasya nang pagkapanalo ay sa tela ng matanda.

44. Halos maghalinghing na siya sa sobrang pagod.

45. Mahirap magpapayat kapag mahilig ka sa pulotgata dahil ito ay sobrang tamis.

46. Nahuli na ang salarin sa kasong pagnanakaw.

47. Hindi ko mapigilan ang aking inis kapag nakikita ko ang kawalang-katarungan.

48. Pinahiram ko ang aking costume sa aking kaklase para sa Halloween party.

49. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

50. Ang pagpapakilala ng bagong lugar o setting ang nagbigay ng bagong perspektibo sa kuwento sa kabanata.

Recent Searches

otraschadknow-howclientsahitdawlutotinitirhanhinanakitkapit-bahaypatutunguhanmakatiinfluentialenforcingabstainingsurgeryheihadplayedbrancheschessreferstransparentcongratsmarkedgraduallyinvolvepeterapollotoohoweverstylesdaigdiglasting4thbwisitnalagutanmaghahatidlamesabinilingbehaviorsyncmegettechnologyreturnedmultoroughexplainsnapicsaanhindriverchefshouldpronounginugunitaaraw-generabapagpapasakitparehongipinikittonotatagalnagpapanggapdevelopedpalantandaanpongnaiyakmasaganangflashsponsorships,magpa-pictureitinaasbinanggacedulapagsasalitafacultybayadhinalungkatgrocerymethodsalexanderasawakatibayangeclipxekaagadbrideaniyabastongobernadorkamatisinspirebankpopularizesarisaringmamitungkolelectoralfysik,matapostanganpinangaralanginiuwisilatactonagitlalibokawili-wiliayokomabangongnapapahintohinilaconocidosenduringhusayraiseestablisheditinulospalengkedrewgiverutilizanhudyateksamkaklasengayonnagpasensiyaisdangmauntogkamaonakapaligidchildrenbutonalamaniniwanpagtitindamakalabasuugud-ugodyunminu-minutonanahimiknasasakupanmakahirammonsignorkanikanilangsampungtresgumalingpinagsanglaantsongikatlongnagpasamasukatinsumalakaypaalambihirangshortinternawaybio-gas-developinggrewboracayramdampiermahahabagenemaarijosesupremetiketreachnoodkasingtigascaraballocarriesbroadislabumabalotlumilingonkriskapondobasahinahasewanmasayapapagalitankumembut-kembotnapakamisteryosoninaisdemocracynangagsipagkantahankamponakaliliyonghumankwenta-kwentanamulatmagpalibrehinipan-hipanpresidentialnangangahoy