Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

37 sentences found for "know-how"

1. "Dogs are better than human beings because they know but do not tell."

2. "The better I get to know men, the more I find myself loving dogs."

3. D'you know what time it might be?

4. Don't beat around the bush with me. I know what you're trying to say.

5. Excuse me, may I know your name please?

6. Hi, we haven't been properly introduced. May I know your name?

7. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

8. I always wake up early to study because I know the early bird gets the worm.

9. I didn't want my sister to know about the family vacation, but my mom let the cat out of the bag by accident.

10. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

11. I don't think we've met before. May I know your name?

12. I don't want to beat around the bush. I need to know the truth.

13. I know I should have apologized sooner, but better late than never, right?

14. I know I should have gone to the dentist sooner, but better late than never.

15. I know I should have started studying earlier, but better late than never, right?

16. I know I'm late, but better late than never, right?

17. I know they're offering free samples, but there's no such thing as a free lunch.

18. I know things are difficult right now, but hang in there - it will get better.

19. I know this project is difficult, but we have to keep working hard - no pain, no gain.

20. I know we're behind schedule, but let's not cut corners on safety.

21. I know you're going through a tough time, but just hang in there - you're not alone.

22. I'm sorry, I didn't see your name tag. May I know your name?

23. It takes one to know one

24. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

25. May I know your name for networking purposes?

26. May I know your name for our records?

27. May I know your name so I can properly address you?

28. May I know your name so we can start off on the right foot?

29. Ngumiti lang sya, I know everything, Reah Rodriguez.

30. Pardon me, but I don't think we've been introduced. May I know your name?

31. Sayang, kamu tahu betapa bahagianya aku bersama kamu. (Darling, you know how happy I am with you.)

32. Some people argue that it's better not to know about certain things, since ignorance is bliss.

33. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

34. Sorry, I didn't catch your name. May I know it again?

35. Though I know not what you are

36. We all know that he's struggling with addiction, but nobody wants to talk about the elephant in the room.

37. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. She has been exercising every day for a month.

2.

3. Anung email address mo?

4. Bumaba na sila ng bundok matapos ang ilang oras.

5. Smoking cessation can have positive impacts on the environment, as cigarette butts and packaging contribute to litter and environmental pollution.

6. The company introduced a new line of lightweight laptops aimed at students and professionals on the go.

7. Cut to the chase

8. Mayroon ka bang kapatid na lalaki?

9. I used a traffic app to find the fastest route and avoid congestion.

10. Ang mailap na kapalaran ay kailangan tanggapin at harapin ng may lakas ng loob.

11. I set my alarm for 5am every day because I truly believe the early bird gets the worm.

12. Bumibili ako ng maliit na libro.

13. Sa paaralan, mahigpit na ipinagbabawal ang anumang uri ng abuso laban sa mga mag-aaral.

14. The website's content is engaging and informative, making it a great resource for users.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. Natawa nanaman sya, Hindi, maganda sya.

17. Hindi ko alam kung kakayanin mo ako, pero sana pwede ba kitang mahalin?

18. At følge sin samvittighed kan nogle gange kræve mod og styrke.

19. Frustration can also be caused by interpersonal conflicts or misunderstandings.

20. Sayang, jangan lupa untuk makan malam nanti. (Dear, don't forget to have dinner tonight.)

21. There are a lot of books on the shelf that I want to read.

22. Alam niyang maganda talaga ang dalaga at hindi totoo ang sinabi niya.

23. Magkano ang tiket papuntang Calamba?

24. Karaniwan sa kasal, mayroong seremonya ng pamamahagi ng singsing at pagbibigay ng halik sa asawa.

25. May dalawang libro ang estudyante.

26. Bakit sila makikikain sa bahay niya?

27. Oh, kinaiinisan mo pala? Eh bakit naging paborito mo?

28. Setiap agama memiliki tempat ibadahnya sendiri di Indonesia, seperti masjid, gereja, kuil, dan pura.

29. Ang mga guro ng musika nagsisilbi upang maipakita ang ganda ng musika sa kanilang mga estudyante.

30. Nasa gitna ng kagubatan kaya hindi mo maiiwasang humalinghing nang malalim.

31. People who give unsolicited advice are a dime a dozen.

32. Claro que entiendo tu punto de vista.

33. Hindi na sila nasisiyahan sa nagiging asal ng bata.

34. Sa takip-silim, maaaring mas mapakalma ang mga tao dahil sa kulay at hangin na mas malumanay.

35. Ibinigay niya ang kanyang pag-ibig at suporta sa gitna ng mga pagsubok.

36. Ngayon ka lang makakakaen dito?

37. Bumili ako ng prutas sa Berkeley Bowl.

38. The Lakers have had periods of dominance, including the "Showtime" era in the 1980s, when they were known for their fast-paced and entertaining style of play.

39. Waring nawawala ang bata dahil hindi niya alam kung saan siya pupunta.

40. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

41. Una mala conciencia puede llevarnos a tomar malas decisiones.

42. The members of the knitting club are all so kind and supportive of each other. Birds of the same feather flock together.

43. Give someone the cold shoulder

44. Tila may bumisita sa bahay kagabi dahil may bakas ng paa sa labas.

45. Saan ka galing? bungad niya agad.

46. Naging kasangkapan ng mga Espanyol ang Katolisismo upang lalong mapadali nila ang pamamalakad dito.

47. Alors que certaines personnes apprécient le jeu comme passe-temps ou forme de divertissement, il peut également conduire à la dépendance et à des problèmes financiers.

48. En invierno, los días son más cortos y las noches son más largas.

49. Ang pagpapakalat ng mga mapanirang balita at kasinungalingan ay nagpapahiwatig ng pagiging bulag sa katotohanan.

50. I am listening to music on my headphones.

Recent Searches

know-howunanbilaobakatinikjuicesamaano-anoadventnakakatawakinikitakinamumuhianthirdmalayonapakamisteryosoipinadakipipinanganakestékumalantogkeepingmagsayangeffortsnagmungkahipresidentialobserverermakahiramkaloobangkapatawarannaabutangapkapilingnasaangmangingisdabrancher,strategiespagkababamakatatlokarwahenghinimas-himaskaguluhannakapagproposetonycometilastokanginaminatamisnasasalinanmagtagosandwichvitamingubatsittingtinigilanstreetnahantadkambingtulanghimayinmakulitmaninipisdistansyanapakagandamakikipag-duetotakotareassumuotdumaanpangalannaging1787nasabingcineblusangfeltcharmingrabereadersnakasahodpumilicallbinabatuwidpaslitdingdingcorrectingventaflypigingkasaganaanagadkumulogcertainmedialivesadvertising,gabi-gabinatanongnapatawaginspirasyonnakahugnakatagotalentnaiyakmakipag-barkadaeskwelahanbatomaghaponmakauwimilyongstaynakakamanghaitinaasnatayostarted:rememberedtibigbihirangnananaginipmadalimagisingbinanggasupilinnarinigiyanpasalamatanbigyangoalhiningisalamorenaattentionspansahitmaydireksyonsystematisksantocanadanapansincoinbaseexampicsdropshipping,magawangevensarilingpublishingnag-oorasyonmurang-murakumukuhanalalaglagnagsusulatnapakagandangnag-iyakannagliliwanaggeologi,laki-lakipinagsikapanmakausapbiyaktitagirlfriendbumisitaalbularyonalalabinagpatuloynamulaklakpulang-pulamusicianbaranggaykumakalansingnapakamotentrancemagkapatidmakidalotig-bebentetreatsnagpepekepanghihiyanginirapanvetoallergyinuulcersabihinna-fundnailigtaspandidirinaglokonamataykasiyahanibinibigaygandahantatayongunitmakakakaenpagpilinakatalungkopaanongnabubuhay