Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

37 sentences found for "know-how"

1. "Dogs are better than human beings because they know but do not tell."

2. "The better I get to know men, the more I find myself loving dogs."

3. D'you know what time it might be?

4. Don't beat around the bush with me. I know what you're trying to say.

5. Excuse me, may I know your name please?

6. Hi, we haven't been properly introduced. May I know your name?

7. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

8. I always wake up early to study because I know the early bird gets the worm.

9. I didn't want my sister to know about the family vacation, but my mom let the cat out of the bag by accident.

10. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

11. I don't think we've met before. May I know your name?

12. I don't want to beat around the bush. I need to know the truth.

13. I know I should have apologized sooner, but better late than never, right?

14. I know I should have gone to the dentist sooner, but better late than never.

15. I know I should have started studying earlier, but better late than never, right?

16. I know I'm late, but better late than never, right?

17. I know they're offering free samples, but there's no such thing as a free lunch.

18. I know things are difficult right now, but hang in there - it will get better.

19. I know this project is difficult, but we have to keep working hard - no pain, no gain.

20. I know we're behind schedule, but let's not cut corners on safety.

21. I know you're going through a tough time, but just hang in there - you're not alone.

22. I'm sorry, I didn't see your name tag. May I know your name?

23. It takes one to know one

24. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

25. May I know your name for networking purposes?

26. May I know your name for our records?

27. May I know your name so I can properly address you?

28. May I know your name so we can start off on the right foot?

29. Ngumiti lang sya, I know everything, Reah Rodriguez.

30. Pardon me, but I don't think we've been introduced. May I know your name?

31. Sayang, kamu tahu betapa bahagianya aku bersama kamu. (Darling, you know how happy I am with you.)

32. Some people argue that it's better not to know about certain things, since ignorance is bliss.

33. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

34. Sorry, I didn't catch your name. May I know it again?

35. Though I know not what you are

36. We all know that he's struggling with addiction, but nobody wants to talk about the elephant in the room.

37. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Nagngingit-ngit ang bata.

2. "Tapos na ang laban, wala nang dapat pang pag-awayan," ani ng punong barangay.

3. Nous avons choisi un thème de mariage champêtre.

4. Different? Ako? Hindi po ako martian.

5. Nagsmile siya, Uuwi ka ha.. uuwi ka sa akin..

6. Some viruses, such as herpes and HIV, can remain in the body for life and cause chronic infections.

7. Napangiti na lang ang binata at sumama sa dalaga, simula ng araw na iyon ay lagi na silang nagkikita.

8. Bis morgen! - See you tomorrow!

9. Ang mga kawal nagsisilbi sa bayan upang protektahan ang mamamayan.

10. Ehrlich währt am längsten.

11. Calcium-rich foods, such as dairy products and tofu, are important for bone health.

12. Kamu ingin minum apa, sayang? (What would you like to drink, dear?)

13. She has learned to play the guitar.

14. Ayaw mo pa ba? tanong niya na nagpakunot sa noo ko.

15. Menghadapi tantangan hidup dengan keberanian dan tekad dapat membantu kita tumbuh dan mencapai tujuan yang kita impikan.

16. Pumasok sa pintuan ang mga atleta nang limahan bago magsimula ang laro.

17. La música es una forma de arte que ha evolucionado a lo largo del tiempo.

18. Inalok niya ako ng mga kakanin na hinugot niya sa kanyang tindahan.

19. Lights the traveler in the dark.

20. The feeling of falling in love can be euphoric and overwhelming.

21. Saan siya nagpa-photocopy ng report?

22. Napakalungkot ng balitang iyan.

23. Ang kanilang panaghoy ay tinugunan ng tulong mula sa mga taong may mabubuting puso.

24. Ang albularyo sa kanilang baryo ay kilala sa kanyang kaalaman sa herbal medicine.

25. Siya ang nagpatuloy sa pag-aagwador.

26. He is running in the park.

27. Mataaas na ang araw nang lumabas si Aling Marta sa bakuran ng kanilang maliit na barung-barong.

28. Sa takip-silim, maaari kang mapakali at magpakalma matapos ang isang mahabang araw.

29. He does not play video games all day.

30. Sa dakong huli, naramdaman ko na wala na akong lakas.

31. The United States has a system of federalism, where power is divided between the national government and the individual states

32. Football referees are responsible for enforcing the rules of the game and ensuring player safety.

33. Ang pagsunod sa batas at regulasyon ay isang paraan ng pagpapakita ng paggalang at pag-itinuring sa sistema ng hustisya.

34. Uncertainty can create opportunities for growth and development.

35. Inakyat ng bata ang puno at tinikman ang bunga.

36. The chef is not cooking in the restaurant kitchen tonight.

37. Everyone knows that she's having an affair, but nobody wants to talk about the elephant in the room.

38. The beaten eggs are then poured into a heated and greased pan.

39. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

40. Kumaripas ang delivery rider para maihatid ang order sa takdang oras.

41. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

42. She carefully layered the cake with alternating flavors of chocolate and vanilla.

43. Inflation kann die Beziehungen zwischen den Ländern beeinträchtigen.

44. Ok ka lang ba?

45. Gising ka pa?! parang nabigla nyang sabi.

46. Da Vinci fue un artista renacentista muy importante.

47. Ang malakas na pagsabog ng bulkan ay binulabog ang buong komunidad.

48. Di nagtagal, muli niyang naramdaman na tila nangangalirang na naman ang kanyang balat.

49. Nagpa-photocopy ng lumang diyaryo

50. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

Recent Searches

know-howmapayapapakikipagtagpopaki-translatekarwahengnapalakasminatamishawakmalayangbibilhinsangaafternoonotraslutorewardingbisikletabanlagomelettelockedubodispositivostirantelaryngitissawathirdsyncpagkababalapisiikutanpinangalanangemailleukemiaalagaoperahanibinaonnakatayominu-minutohoneymoonlumilipadabut-abotbayanisabongnangangahoymakausaplupainmataaasandoyayudakelanilanamerikamaalwangallowingisuganagtagpooliviapinagsasasabi2001tag-ulanbumahasinagothigaanmatikmankargatatlongmagkakasamaburolwallethumampaskinanatatakottoribiomaaksidentealamnamungamasayakawayandiseasequicklygrabemusichalamananlumamangogorconvey,bantulotpagkaangatnayoninilistaoutlinekasingsiksikanmatayogtitotsonggosugatangpantalongnaiinispwestobangkangiphoneexpectationsbakitnagpuyosnagtutulungangratificante,naglalatangnakaliliyongmarchipagamotbilhinbusyangkamatismanilbihanpaaselaweddingdreamnagbasagenepaghinginiligawansumalamamitekstsueloginisingrosenasiyahandiwatagandahansinasadyatig-bebentesiniyasatminabutisaritaespecializadasmalezanakapapasongpinagpatuloymakapaltumawamagkasakitkamiasnapapahintowatawatlumipadstaytumatawadkumampimahuhulihaponkinalimutantilipatongcoughingturonemocionalfollowedmaya-mayaisinamaininomxviiniyonpinapakingganbataanitonunopaksabukasiyonninongbinigyantomorrowgrowthlangkaypnilitganunalmacenarlegislationmapagbigaynapapalibutancreateedsadefinitivowidelypinalayassalitangrabbasakinsearchtoothbrushbatosilbing1000farrolledipipilitheischedule