Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

72 sentences found for "known"

1. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

2. Allen "The Answer" Iverson was a lightning-quick guard known for his scoring ability and crossover dribble.

3. Amazon's customer service is known for being responsive and helpful.

4. Andrew Jackson, the seventh president of the United States, served from 1829 to 1837 and was known for his expansion of democracy and his controversial policies towards Native Americans.

5. Angelina Jolie is an acclaimed actress known for her roles in films like "Tomb Raider" and "Maleficent."

6. Ariana Grande is an American singer, songwriter, and actress known for her wide vocal range and powerful voice.

7. Basketball players are known for their athletic abilities and physical prowess, as well as their teamwork and sportsmanship.

8. Beyoncé is a highly acclaimed singer, songwriter, and actress known for her powerful performances and chart-topping hits.

9. Bitcoin is the first and most well-known cryptocurrency.

10. Brad Pitt is known for his charismatic performances in movies such as "Fight Club" and "Ocean's Eleven."

11. Cate Blanchett is an acclaimed actress known for her performances in films such as "Blue Jasmine" and "Elizabeth."

12. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

13. Congress are elected every two years in a process known as a midterm election

14. Dwayne "The Rock" Johnson is a former professional wrestler turned actor, known for his roles in films like "Jumanji" and the "Fast & Furious" franchise.

15. Dwyane Wade was a key player in the Miami Heat's championship runs and known for his clutch performances.

16. Einstein was known for his sense of humor and his love of sailing.

17. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

18. Elvis Presley, also known as the King of Rock and Roll, was a legendary musician, singer, and actor who rose to fame in the 1950s

19. Football is also known as soccer in some countries, particularly in the United States.

20. Football is known for its intense rivalries and passionate fan culture.

21. Franklin Pierce, the fourteenth president of the United States, served from 1853 to 1857 and was known for his support of the Kansas-Nebraska Act, which contributed to the outbreak of the Civil War.

22. Grover Cleveland, the twenty-second and twenty-fourth president of the United States, served from 1885 to 1889 and from 1893 to 1897, and was known for his economic policies and opposition to corruption.

23. Hairdressing scissors, also known as shears, have different blade designs for different cutting techniques.

24. He is also remembered for his generosity and philanthropy, as he was known for his charitable donations and support of various causes

25. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

26. He was known for his active and controversial presence on social media, particularly Twitter.

27. He's known to exaggerate, so take what he says with a grain of salt.

28. Hockey is known for its physicality, with players often engaging in body checks and other forms of contact during the game.

29. Hugh Jackman is best known for his portrayal of Wolverine in the "X-Men" film series and his Tony Award-winning performance in the musical "The Boy from Oz."

30. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

31. James Madison, the fourth president of the United States, served from 1809 to 1817 and was known as the "Father of the Constitution."

32. James Monroe, the fifth president of the United States, served from 1817 to 1825 and was known for his foreign policy doctrine that became known as the Monroe Doctrine.

33. Jennifer Lawrence won an Academy Award for her role in "Silver Linings Playbook" and is known for her performances in the "Hunger Games" series.

34. Johnny Depp is known for his versatile acting skills and memorable roles in movies such as "Pirates of the Caribbean" and "Edward Scissorhands."

35. Julia Roberts is an Academy Award-winning actress known for her roles in films like "Pretty Woman" and "Erin Brockovich."

36. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

37. Kawhi Leonard is known for his lockdown defense and has won multiple NBA championships.

38. Known for its sunny weather, Los Angeles enjoys a Mediterranean climate throughout the year.

39. Kobe Bryant was known for his incredible scoring ability and fierce competitiveness.

40. LeBron James is an exceptional passer, rebounder, and scorer, known for his powerful dunks and highlight-reel plays.

41. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

42. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

43. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

44. Musk is known for his ambitious goals and his willingness to take on seemingly impossible challenges.

45. Nicole Kidman is an Academy Award-winning actress known for her performances in movies such as "Moulin Rouge!" and "The Hours."

46. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

47. Russell Westbrook is known for his explosive athleticism and ability to record triple-doubles.

48. Scarlett Johansson is a prominent actress known for her roles in movies like "Lost in Translation" and as Black Widow in the Marvel films.

49. Shaquille O'Neal was a dominant center known for his size and strength.

50. Some kings have been known for their military conquests, such as Alexander the Great and Napoleon Bonaparte.

51. Tesla has a strong and passionate community of supporters and customers, known as "Tesla enthusiasts" or "Teslaites."

52. Tesla is known for its innovative electric car models, including the Model S, Model 3, Model X, and Model Y.

53. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

54. The billionaire was known for his charitable donations to hospitals and schools.

55. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

56. The Easter Island statues, known as Moai, are a mysterious wonder of ancient stone sculptures.

57. The French omelette is a classic version known for its smooth and silky texture.

58. The Galapagos Islands are a natural wonder, known for their unique and diverse wildlife.

59. The LA Lakers, officially known as the Los Angeles Lakers, are a professional basketball team based in Los Angeles, California.

60. The Lakers have had periods of dominance, including the "Showtime" era in the 1980s, when they were known for their fast-paced and entertaining style of play.

61. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

62. The Northern Lights, also known as Aurora Borealis, are a natural wonder of the world.

63. The President is elected every four years through a process known as the presidential election

64. The study of viruses is known as virology, and scientists continue to make new discoveries about these complex organisms.

65. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

66. The United States is known for its entertainment industry, including Hollywood movies and Broadway shows.

67. Tom Cruise is a highly successful actor known for his roles in movies like "Top Gun" and the "Mission: Impossible" series.

68. Tom Hanks is an Academy Award-winning actor known for his roles in movies like "Forrest Gump" and "Saving Private Ryan."

69. Trump was known for his background in real estate and his role as a television personality on the show "The Apprentice."

70. Twitter is known for its role in breaking news and providing a platform for public discussions and debates.

71. Will Smith is a versatile actor and rapper known for his roles in films like "Men in Black" and "The Pursuit of Happyness."

72. With the Miami Heat, LeBron formed a formidable trio known as the "Big Three" alongside Dwyane Wade and Chris Bosh.

Random Sentences

1. Isang araw nagkasakit si Aling Rosa.

2. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

3. Ipinahamak sya ng kanyang kaibigan.

4. Paborito nyang panoorin ang Baby shark sa youtube.

5. Ang magulang na mabuti, ang anak na sumusunod.

6. Efter fødslen kan der være en følelse af lettelse og glæde over at have en ny baby.

7. Bukas ay pumunta daw po kayo sa school sabi ng aking teacher.

8. Emphasis can help to ensure that a message is received and understood by the intended audience.

9. Einstein's writings on politics and social justice have also had a lasting impact on many people.

10. Sa tingin mo ba may balak ako? he grins.

11. He realized too late that he had burned bridges with his former colleagues and couldn't rely on their support.

12. Si Doming na nagkaroon ng kasintahan na maganda ay inagaw ng kanyang kaibigan

13. Paano magluto ng adobo si Tinay?

14. Ang kaniyang pamilya ay disente.

15. Ang tag-ulan ay isa sa mga panahon ng taon na nagdadala ng malakas na pag-ulan at kadalasang nagdudulot ng baha at landslides.

16. Dapat natin kontrolin ang pagmamalabis sa paggamit ng social media upang hindi ito makaapekto sa ating mental na kalusugan.

17. Athena magpagaling ka.. sabi naman ni Abi.

18. Sa kabila ng paghihinagpis, nagsikap ang mga residente na bumangon matapos ang trahedya.

19. Tuluyan na siyang pumasok ng kwarto at isinara yung pinto.

20. Nogle helte er kendte for deres modige handlinger under krig.

21. Pinagpalaluan ang Kanyang karunungan.

22. If you want to secure a good seat at the concert, you have to arrive early - the early bird gets the worm.

23. Emphasis can be used to highlight a person's strengths and abilities.

24. Sa gitna ng pagluluto, nagitla ako nang biglang mag-expire ang gasera.

25. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

26. Hindi ako nakatulog sa eroplano.

27. Hindi naman halatang type mo yan noh?

28. Ang pagdadasal ng rosaryo tuwing alas-sais ng gabi ay isang ritwal na hindi nila kinalilimutan.

29. Nagpahayag ng reklamo ang mga estudyante dahil sa sobrang lamig sa silid-aralan.

30. The patient was discharged from the hospital after recovering from pneumonia.

31. Simula noon ang batang si Amba ay naging unang gagamba.

32. Nous avons opté pour une cérémonie de mariage intime.

33. Nagalit ang diwata sa ginawa ng madamot na matanda.

34. Kung walang panget, walang pagbabasehan ng ganda niyo!

35. Matagumpay akong nakapag-alaga ng mga halaman kaya masayang-masaya ako ngayon.

36. Hoy en día, el internet es una parte integral de la vida cotidiana.

37. Sa mga siyudad, mahalaga rin ang mga punong-kahoy dahil nakakatulong ito sa pagpapalinis ng hangin.

38. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

39. Inflation kann die Arbeitsbelastung der Zentralbank erhöhen.

40. Diretso lang, tapos kaliwa.

41. Sabi ko sa inyo, halos kumpleto kami kasi wala si Sync.

42. May naisip lang kasi ako. sabi niya.

43. She always submits her assignments early because she knows the early bird gets the worm.

44. Sumakay kami ng kotse at nagpunta ng mall.

45. Ang Mabini Bridge ay isang makasaysayang tulay sa Lipa City, Batangas.

46. Ang tubig-ulan ay maaaring magdulot ng pagkakatanggal ng mga mapanganib na mikrobyo sa mga kalsada at iba pang mga lugar.

47. Elon Musk is a billionaire entrepreneur and business magnate.

48. Twitter chats are organized conversations on specific topics, usually held at designated times using a specific hashtag.

49. Nahuli na kahapon ang nagnakaw ng kalabaw ni Mang Arturo.

50. Nagtataka ako kung bakit hindi mo na ako tinutulungan tulad ng dati.

Recent Searches

knownayokobakitnaaliskinamumuhiannapakamisteryosopresidentialunti-untikaloobangtangeksmakahiramdescargarkamalayannatitirangkakutisnahantadgymnasanplasanakikitakelanresponsiblebitbitwhiletumatawamagsasalitapinipilitnangampanyapinakamatapatmakikitahumalakhakvirksomheder,unibersidadhumahangosturismonapapatungonagpatuloynagpabayadpaki-translatekumitanagkakasyabutilnakikilalangininombarangaykalakingnaibibigayexpressionsberegningerstreamingbeforehiwamegetnalamanpalabuwayapansamantalapinakidalanakakatandamakukulaymagalangbayawaknabighanisharmainenalakienvironmentneedsoncenagsabayknowsmagpasalamatnapakatagalmaayospaligsahanedukasyonbestfriendbarrerasevennalulungkotnalugmoksasabihinuugud-ugodpagtawahumiwalaymembersnegrosgirlnawalanglegendskaaya-ayangkwenta-kwentaipapainitmasayahinarbejdsstyrketotoongpelikulanagtagalibabawsaranggolapauwibinuksankampananaiisipkilaynagmakaawakumakantabiromahinogtatanggapinestablishednaglaroincluirinabutanpasyentekolehiyocorporationmauliniganopisinaroletumalimmaabutanclientenearnavigationtopicapelyidotilgangkommunikerermagpaniwalapabulongbuwenasnamumulahinahanapmagdaraoskulturkikitafragitanaskahilinganfarmnobodynaminpinakamatunogginanuhadvancementkarapatangsinenabigkastotoonagtaposiniuwiwalongapppagkapasokpaladpagtangisstayadgangmagbibiyahehinawakanmahinangatensyongpinahalatabarlibrenandayawellgawingpagiisipmateryalesnewspapersbio-gas-developingbenefitspinaulanandennenaawanatuyoiwanannailigtasbaryonatuloypaglakinag-iinomcantidadnaghubadnapapikitnapawibighanidogsoperahanpitoinferioresmagbabakasyoninterviewingeducativasbumagsaknangingitngitpalayoamuyin