Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "term"

1. Accomplishing a long-term goal can create a sense of euphoria and relief.

2. Baby fever is a term often used to describe the intense longing or desire to have a baby.

3. Cheating can occur in both short-term and long-term relationships, and can affect couples of any age, race, or sexual orientation.

4. Environmental protection requires a long-term vision and commitment to future generations.

5. Investing can be a long-term strategy for building wealth and achieving financial goals.

6. Investing requires discipline, patience, and a long-term perspective, and can be a powerful tool for achieving financial goals over time.

7. Investment strategies can range from active management, in which an investor makes frequent changes to their portfolio, to passive management, in which an investor buys and holds a diversified portfolio over the long term.

8. Leukemia can be cured in some cases, but long-term monitoring is necessary to prevent relapse.

9. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

10. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

11. The stock market can be used as a tool for generating wealth and creating long-term financial security.

Random Sentences

1. I used my credit card to purchase the new laptop.

2. El que espera, desespera.

3. The Galapagos Islands are a natural wonder, known for their unique and diverse wildlife.

4. The momentum of the rocket propelled it into space.

5. Limitations can be viewed as opportunities for growth and personal development.

6. Tinawag nilang ranay ang insekto na katagalan ay naging anay.

7. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

8. Kapag may tiyaga, may nilaga.

9. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

10. Ako ay nag-aalala para sa aking pamilya, datapwat wala akong magagawa para sa kanila ngayon.

11. Matutulog ako mamayang alas-dose.

12. I prefer to arrive early to job interviews because the early bird gets the worm.

13. Kailangan nating mag-ingat sa kalusugan upang maiwasan ang mga sakit, samakatuwid.

14. Pada umumnya, keluarga dan kerabat dekat akan berkumpul untuk merayakan kelahiran bayi.

15. Sa panahon ng digmaan, madalas na nagkakaroon ng migrasyon at pagkawala ng mga tao sa kanilang tahanan.

16. El algodón es un cultivo importante en muchos países africanos.

17. The children play in the playground.

18. Binigyan sya ng dentista ng gamot matapos syang bunutan ng ngipin.

19. Money can take many forms, including cash, bank deposits, and digital currencies.

20. Sino-sino ang mga kakuwentuhan mo sa klase?

21. LeBron has used his platform to advocate for social justice issues, addressing inequality and supporting initiatives to effect positive change.

22. Tinangka niya itong pigilan ngunit huli na ng naabutan niya ang matanda.

23. Hindi ko ho kayo sinasadya.

24. A couple of goals scored by the team secured their victory.

25. The king's subjects are the people who live in his kingdom and are under his rule.

26. Ipaliwanag ang mga sumusunod na salita.

27. Omelettes are a popular choice for those following a low-carb or high-protein diet.

28. Malapit na ang halalan kaya't nagsulputan na naman ang mga samu't saring pagbati ng mga pulitiko.

29. The vertical axis of an oscilloscope represents voltage, while the horizontal axis represents time.

30. Pagtitinda ng bulakalak ang kanilang ikinabubuhay.

31. The river flows into the ocean.

32. Some people view money as a measure of success and achievement, while others prioritize other values.

33. Ayaw niya ng maarteng palabas kaya lagi siyang nakatago sa kanyang kwarto.

34. Christmas is observed by Christians around the world, with various customs and traditions associated with the holiday.

35. Have you studied for the exam?

36. Sa mga matatandang gusali, naglipana ang mga alamat at mga kuwento ng nakaraan.

37. Narinig ng mga diyosa ang kayabangan ng bata.

38. Videnskab er systematisk undersøgelse af natur og universet ved hjælp af metoder som observation, eksperimentering og analyse

39. Ang tubig-ulan ay maaaring gamitin sa pagsasaka at iba pang mga pangangailangan ng mga tao.

40. Supportive care, such as blood transfusions and antibiotics, may be necessary to manage complications of leukemia treatment.

41. Kumunot lang ang noo ko, That's not my name.

42. Jeg har været forelsket i ham i lang tid. (I've been in love with him for a long time.)

43. Halos nakalimutan na ng mag-asawa ang nangyari sa diwata.

44. Sa gitna ng kaharian ng Renaia, isang dalaga ang nakatira sa munting palasyo.

45. Sa kaibuturan ng aking puso, alam kong tama ang aking ginagawa.

46. Matumal ang bentahan ng bulaklak ngayong lockdown.

47. Ang biglang pagkakaroon ng mga protesta ay binulabog ang kapayapaan ng lungsod.

48. E ano kung maitim? isasagot niya.

49. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

50. Kina Lana. simpleng sagot ko.

Similar Words

determinasyonterminomidterm

Recent Searches

minerviediapertruetermmaglabawealthprobinsyachambersunconstitutionalmandirigmangnakauslingbagongrestawanamoynag-iisangna-suwayrolledparamerematikmanmakuhatelefonshopeepapagalitannegro-slavesnagtrabahokatawangvideos,pakistanipinatawagbeautyproducenailigtasrightprosperkumaripassofapangilmagdaansasamabubonghampaslupakare-kareorugapaymatulismagpuntamedievalnagtaposexigentesmokealituntuninmaratingpinabulaansweetestarisipintiyagloriakuwebaabundanteumiwaspagtataashinanakittenidonakauwitelangbobonabigyanalmusalkalupiihahatidmatagal-tagaldoesnegosyantebiglangkinumutanbumibitiwpinagbigyandumadatingpatiencesumuotbooksnocheawitinnahihiyangtataasrenombreumiimikdalhananilaitaasnagbigayleadingnalamanpagbibiromatapanglilipadhumiwalaypnilitsumusulatfathersamantalangpagsasalitaeveninggoalmaramingnasuklammakasamapangingimiapollomatamahahalikdraft,bihirangairconsinasadyasinisirahellonovellesmasungitmangingisdangcitizenskatutubokuneproductionhumahangospagkagisingarbejdernagmamadalisciencekongpaliparinpapuntapekeansalaminbokkaedadbeybladeisinisigawmaluwanggreatkaybilisbilaobinibiniscalehispumilimaka-alisdumilatparikahitmaaksidentekwelyofreelancerbilhinhomenagbantaytinutopbarongbayangnatulakasimbinasa4theskuwelahansingsingbalotjailhouselookedgiverpalakatirangmabirosetreachalexandersequeofficemapahamakbasketisinusuotmanuelumakbaytatlumpungmaramotpasasalamatitsuravedinilabasarabianabanggamakasalanangleftnangangahoyseveraltaun-taondecisionsfredmataray