Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "term"

1. Accomplishing a long-term goal can create a sense of euphoria and relief.

2. Baby fever is a term often used to describe the intense longing or desire to have a baby.

3. Cheating can occur in both short-term and long-term relationships, and can affect couples of any age, race, or sexual orientation.

4. Environmental protection requires a long-term vision and commitment to future generations.

5. Investing can be a long-term strategy for building wealth and achieving financial goals.

6. Investing requires discipline, patience, and a long-term perspective, and can be a powerful tool for achieving financial goals over time.

7. Investment strategies can range from active management, in which an investor makes frequent changes to their portfolio, to passive management, in which an investor buys and holds a diversified portfolio over the long term.

8. Leukemia can be cured in some cases, but long-term monitoring is necessary to prevent relapse.

9. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

10. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

11. The stock market can be used as a tool for generating wealth and creating long-term financial security.

Random Sentences

1. Real estate investing: Invest in real estate through online platforms like Fundrise or Roofstock

2. The uncertainty of the future can cause anxiety and stress.

3. Me siento mejor cuando me rindo al destino y acepto que "que sera, sera."

4.

5. Ang salarin ay nahuli matapos ang matagal na manhunt ng mga awtoridad.

6. Viruses can mutate and evolve rapidly, which can make them difficult to treat and prevent.

7. Pagkain ko katapat ng pera mo.

8. Some of the greatest basketball players of all time have worn the Lakers jersey, including Magic Johnson, Kareem Abdul-Jabbar, Jerry West, Elgin Baylor, and Kobe Bryant.

9. May himig pangungutya ang tinig ng pulis.

10. Landet er et af de førende lande i verden inden for økologisk landbrug, og det er også et af de førende lande inden for vedvarende energi

11. Ang mga nanonood ay para-parang nangapatdan ng dila upang makapagsalita ng pagtutol.

12. Omelettes are a popular choice for those following a low-carb or high-protein diet.

13. Hashtags play a significant role on Instagram, allowing users to discover content related to specific topics or trends.

14. Tantangan hidup dapat memperkuat hubungan dengan orang-orang terdekat, karena mereka dapat memberikan dukungan dan perspektif yang berharga.

15. Mahilig akong makinig ng music kaya laging nahuhumaling sa mga bagong kanta.

16. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

17. May mga turista na nagpasyang lumibot sa pamamagitan ng bisikleta para mas mapadali ang kanilang paglalakbay.

18. Handa na bang gumala.

19. La motivation est un élément clé de la réussite, car elle permet de maintenir un niveau d'engagement élevé dans l'accomplissement d'un objectif.

20. Nahigitan na nito ang kakayanan ng kanyang ama at ina.

21. Mahirap maging may agam-agam sa buhay dahil ito ay maaaring magdulot ng pagkabalisa.

22. Les mathématiques sont une discipline essentielle pour la science.

23. The goal of investing is to earn a return on investment, which is the profit or gain earned from an investment.

24. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

25. Nag-aalala ako sa mga pinagdadaanan ng aking nililigawan at lagi kong inuunawa ang kanyang mga kailangan.

26. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

27. La realidad es que las cosas no siempre salen como uno espera.

28. Kung kasamaan pa rin ang nasa iyong pagiisip, sanay huwag kanang makatayo.

29. Napunit ang papel ng saranggola dahil sa malakas na hangin.

30. Red horse? Ikaw? nagtatakang tanong ni Genna.

31. Nationalism has played a significant role in many historical events, including the two World Wars.

32. Hinanap nito si Bereti noon din.

33. Hinatid ako ng taksi sa bahay ni Mrs. Lee.

34. El cultivo de olivos es una actividad tradicional en el Mediterráneo.

35. Pupunta ako sa Madrid sa tag-araw.

36. Ignorieren wir unser Gewissen, kann dies zu einem schlechten Gewissen und Schuldgefühlen führen.

37. Binuksan ko ito at binasa yung nakalagay.

38. Es importante tener en cuenta que el clima y el suelo son factores importantes a considerar en el proceso de cultivo del maíz

39. Umuuwi siya sa probinsiya linggo-linggo.

40. Inakalang nalimutan siya ng kaibigan, pero nagulat siya sa sorpresa nito.

41. Pasensiya na kayo, Ale, sabi ng bata.

42. Kaano-ano mo si Juan Dela Cruz?

43. She admires the beauty of nature and spends time exploring the outdoors.

44. Ah salamat na lang, pero kelangan ko na talagang umuwi.

45. Sueño con viajar por todo el mundo. (I dream of traveling around the world.)

46. Binansagang "Gymnastics Prodigy" si Carlos Yulo dahil sa kanyang talento at husay.

47. A successful father-child relationship often requires communication, patience, and understanding.

48. Los desastres naturales, como las inundaciones y sequías, pueden tener un impacto significativo en el suministro de agua.

49. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

50. George Washington was the first president of the United States and served from 1789 to 1797.

Similar Words

determinasyonterminomidterm

Recent Searches

termkaragatannamingcoatelectionsrailtryghedperlaipagamotlegendsconectadosnakikilalangpagpapatubonakaluhodmakikitanagpapaniwalamagtatagalnagngangalangnagliliyabtennisdistansyamakalaglag-pantypapanhikbloggers,buung-buongingisi-ngisingmalezaisinulatkasaganaannagkakakainnaabutanbabasahinpanghihiyangnagkalapitmagkapatidmaglalaronagreklamotumahanmasasayakalabawmarurumipakakatandaantumatawagnalalabingyoutube,productividadtraditionalnaghihiraplalabhanamericamarasigannagsmilepaglalabamagbibigaytumalimwatawatmasaholkangitankulturmaasahannai-dialpahaboldropshipping,escuelaskindergartensakenisinalaysaylumipadmagisipdireksyonsementeryooperativoskastilangdisenyowakasmaranasanbarongplanning,gulangmabibingiairplanesvegascarlomaistorbomartialnaislarangannapagodkutodmatipunobiyasflexiblegabrielbusypanobalatandreskulaysikochickenpoxkuyaresignationburmabecomingpaskosuccessfultinderaguhitsumayaindustrymailaphitsuraiintayinmagpuntaheargisingleoasulusawordremainestarboyhimselfpananimpapuntaexitfloornucleardeviceschambersmascoachinggoingalignsseparationissueswebsitemainstreampneumoniaguiltyeviloffentliglumalangoypagkikitabangkangbayanfascinatinginaabutanlitonakuhahanap-buhaypauwigasumutangtelephonepagtitiponaggressionendvidereengkantadastapleasiaticnalugidyanschoolparatingipapautangnearoofstockkindledumaramiparoleskuwelagapuntimelynaabotaksidentenoongtodaydyipnikasikatapatpinagsanglaannapatingintataytinikpresentaalapaapkaraokeseryosobingopublicityofrecensisternagisingtibokipagmalaakisalatinsikipstreet