Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

24 sentences found for "information"

1. A couple of phone calls and emails later, I finally got the information I needed.

2. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

3. Bagaimana cara mencari informasi di internet? (How to search for information on the internet?)

4. Det har ændret måden, vi interagerer med hinanden og øget vores evne til at dele og få adgang til information

5. Elektronik kan hjælpe med at forbedre adgangen til information og vidensdeling.

6. Emphasis is often used to highlight important information or ideas.

7. Fra telefoner til computere til tv'er, elektronik har revolutioneret måden, vi kommunikerer og får adgang til information

8. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

9. It's important to read food labels to understand ingredients and nutritional information.

10. It's never a good idea to let the cat out of the bag when it comes to confidential information - it can have serious consequences.

11. Privacy settings on Facebook allow users to control the visibility of their posts, profile information, and personal data.

12. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

13. spread information and knowledge from one corner of the globe to another.

14. The company suffered from the actions of a culprit who leaked confidential information.

15. The information might be outdated, so take it with a grain of salt and check for more recent sources.

16. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

17. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

18. The waveform displayed on an oscilloscope can provide valuable information about signal amplitude, frequency, and distortion.

19. The website has a lot of useful information for people interested in learning about history.

20. The website's search function is very effective, making it easy to find the information you need.

21. This can include correcting grammar and spelling errors, reorganizing sections, and adding or deleting information

22. TV can be used for educating the masses, for bringing to us the latest pieces of information audio-visually and can provide us with all kinds of entertainment even in colour.

23. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

24. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. Bigla niyang mininimize yung window

2. Nakaka-bwisit talaga ang nangyari kanina.

3. Ang hudyat ay maaaring maging simpleng galaw o kilos, o maaaring isinasaad sa pamamagitan ng komplikadong simbolo o wika.

4. Dun na nga raw pala tayo dumeretso sabi ni Tita Andrea.

5. Kahit hindi ka magaling sa pagguhit, puwede ka pa ring matuto at mag-improve sa pagguhit.

6. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

7. Maraming aklat ang naisulat tungkol kay Apolinario Mabini at ang kanyang kontribusyon sa kasaysayan ng Pilipinas.

8. Yung totoo? Bipolar ba itong nanay ni Maico?

9. Negative self-talk and self-blame can make feelings of frustration worse.

10. Humihingal at nakangangang napapikit siya.

11. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

12. Narito ang pagkain mo.

13. Les voitures autonomes utilisent des algorithmes d'intelligence artificielle pour prendre des décisions en temps réel.

14. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

15. The experience of bungee jumping was both terrifying and euphoric.

16. Sa kanyang pagsasalita, siya ay nagdudumaling ng kanyang mga salita upang maiparating ang kahulugan ng mensahe.

17. Paulit-ulit na niyang naririnig.

18. Tinanggap niya ang lahat ng ito at marami pang iba sa kaniyang kaarawan.

19. Sa pangalan ni Apolinario Mabini binuo ang isang award ng Department of Social Welfare and Development para sa mga organisasyong may malaking kontribusyon sa pagtugon sa mga pangangailangan ng mga mahihirap sa lipunan.

20. Tinignan nya ilan sa mga ginawa ko, Okay na yan.

21. Amazon's Kindle e-reader is a popular device for reading e-books.

22. Mula nuon, sa gubat namuhay ang mga matsing.

23. Las redes sociales pueden ser una fuente importante de noticias y eventos actuales.

24. The little boy was happy playing in his sandbox, unaware of the problems of the world - ignorance is bliss when you're that age.

25. Siya ay nangahas na mag-apply sa isang prestihiyosong unibersidad kahit mababa ang kanyang kumpiyansa.

26. The flowers are not blooming yet.

27. Ang kamalayan sa mga sintomas ng kalusugang pang-mental ay maaaring makatulong sa agaran at tamang pangangalaga.

28. Sa takip-silim, nakakapagbigay ng magandang silip sa mga bituin at buwan.

29. Dapat pa nating higpitan ang seguridad ng establisimyento, mungkahi naman ng manager.

30. Los héroes son capaces de superar sus miedos y adversidades para proteger y ayudar a los demás.

31. Ang kanyang malalim na pangarap ay animo'y imposibleng maabot ngunit patuloy pa rin siyang nagsusumikap.

32. Sa mga malulubhang kaso, kailangan ng pagpapakonsulta sa espesyalista na dentista.

33. I prefer to arrive early to job interviews because the early bird gets the worm.

34. Mange steder i Danmark afholdes der påskeoptog og andre offentlige begivenheder i løbet af Holy Week.

35. Mahina ang internet sa inyong lugar? Kung gayon, baka mas mabuting gumamit ng mobile data.

36. Nagpapasalamat ako sa Bukas Palad dahil sa kanilang mga kanta ay nakakatulong sa akin na maging mas malapit sa Diyos.

37. Hindi ko alam kung kailan magiging tamang oras, pero sana pwede ba kita makilala?

38. Kahapon, nakita ko siyang tulala sa parke nang walang pakialam sa mga taong nasa paligid niya.

39. Hihiramin ko ang iyong tools para sa aking proyekto sa bahay.

40. Dapat bigyang-pansin ang pangamba ng mga bata at tulungan silang maunawaan ang mga posibleng banta.

41. Kanino ka nagpagawa ng cake sa birthday mo?

42. The news might be biased, so take it with a grain of salt and do your own research.

43. Ilan ang batang naglalaro sa labas?

44. Hindi maaring magkaruon ng kapayapaan kung ang marahas na kaguluhan ay patuloy na magaganap.

45. Completing a difficult puzzle or solving a complex problem can create a sense of euphoria.

46.

47. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

48. It's important to be careful when ending relationships - you don't want to burn bridges with people you may encounter in the future.

49. Bilang paglilinaw, ang proyekto ay hindi kanselado kundi ipinagpaliban lamang.

50. Dahil sa lockdown ay bumagsak ang ekonomiya ng Pilipinas.

Recent Searches

nagagandahannaglalaroasahaninformationkalaropagsahodlamandollarpagbabanta1929primerostodaysabihingkumaripasmalikotmedievalhampaslupaknightandamingcornerpriestutilizanmagagamitexpectationskinalalagyanrestawranibinentalorimakesdoonsutilnapapikitrestnagcurvebranchinteligentessalapijamesconnectingjeromesulyapmakatulogzoomanonoodmestgrabeipaliwanagbulalaskasamaandahilnagpasalamatmanirahanmaidkaninamalapitpartnergitnamaibigayiniangatmalinisinlovelimittrapikhinipan-hipangawingimagessumisilipbungadbalakpumilikumainiiklimailaphangaringgurohirapsapagkatindenprutasbiglanagpasyamalulungkotpasinghalmasamadomingomasayahinlagaslaskomunidadganidcorporationproblemalupatinanggalngunitcomunicarsedapit-haponworryyanpagkabatananaynasakayafuecigarettemanatilimaaringmakukulaytrajenagmamaktolmagkaibangpasantunaydalhinmaaksidentediscipliner,commercialbinibilinakihalubiloduguantutungoplatformspropesorparingirllalakadnaghilamoskubyertoskumitavelstandviolencebinilikinalimutantatanggapinnaglahonapakahabarevolutionizedtanonggayunpamanmalayaidinidiktaakmangnaliligobumililaruinmadurasbihirakongtaga-nayonnuclearipinanganakartistacnicosportsproducemamayapinagmamalakinakikiasumasayawhinilanakalagaymagagawarodonasakimkindlenakangisinatabunanfarmasayagreenpanghabambuhaymasarapkumakaintanyagbinibilangkatedralhawaiinagpepekeunanramdamnapakasinungalingiskostoupangnangingilidnawalangshortaddictionmagkapatidexpresancolournaglakadnakikitahitik300susitinulak-tulakkampeonnaantigturonleksiyon