Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "matching"

1. Yeah. masayang sabi ni Chad with matching thumbs up.

Random Sentences

1. Scientific analysis has revealed that some species are at risk of extinction due to human activity.

2. Musk's SpaceX has successfully launched and landed reusable rockets, lowering the cost of space exploration.

3. Dahil sa patuloy na pagtitiyak sa kalidad ng mga produkto at serbisyo, yumabong ang negosyo ng isang kumpanya.

4. I didn't want my sister to know about the family vacation, but my mom let the cat out of the bag by accident.

5. Twinkle, twinkle, little star,

6. Naaalala mo pa ba noong tayo pang dalawa.

7. Sa kanyang paglalakad sa kahabaan ng dagat, napadungaw siya sa malalaking alon at namangha sa kanilang ganda.

8. Ang manunulat ay nagsusulat ng nobela na nagpapakita ng kaniyang malikhain na imahinasyon.

9. Mi amigo me enseñó a tocar la guitarra y ahora podemos tocar juntos.

10. Cancer can be diagnosed through medical tests, such as biopsies, blood tests, and imaging scans.

11. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

12. Bawal kumain sa loob ng silid-aralan upang mapanatili ang kalinisan ng paaralan.

13. El aloe vera es una hierba medicinal conocida por sus propiedades curativas para la piel.

14. Det er vigtigt at huske heltenes bedrifter og lære af dem.

15. Paano ho ako pupunta sa Palma Hall?

16. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

17. Kings may wield absolute or constitutional power depending on their country's system of government.

18. At tuluyang nagliwanag ang buong paligid at nawala ang dalawa.

19. Ang laki ng wedding cake na ginawa ng kanyang ate.

20. Pinag-iingat ng mga awtoridad ang mga mamamayan laban sa mga salarin na gumagala sa paligid.

21. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

22. El color y la textura son elementos fundamentales en la pintura.

23. Instagram offers insights and analytics for users with business accounts, providing data on post performance and audience demographics.

24. Sa gitna ng mga problema sa trabaho, hindi maiwasang ikalungkot niya ang kakulangan ng suporta mula sa kanyang boss.

25. Rektanggulo ang hugis ng mesa namin.

26. The children eagerly lined up for their share of the birthday cake.

27. It has been found that by abstaining from smoking a person may be cured of many diseases

28. Hindi ako sang-ayon sa mga komento na narinig ko tungkol sa iyo.

29. Les maladies cardiaques, le cancer et le diabète sont des problèmes de santé courants dans de nombreux pays.

30. Ang hirap naman ng exam nakaka bobo.

31. Mahal ang mga bilihin sa Japan.

32. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

33.

34. Cinderella is a tale of a young girl who overcomes adversity with the help of her fairy godmother and a glass slipper.

35. Ngunit kahit ganyan ang kinalalagyan.

36. "Ang hindi marunong lumingon sa pinanggalingan ay hindi makakarating sa paroroonan" ay isang bukambibig na nagpapaalala na mahalaga ang pag-alala at pagpahalaga sa mga pinagmulan.

37. El nacimiento puede ser un momento de reflexión y celebración, y puede marcar el comienzo de una nueva etapa en la vida de la familia.

38. Si Tony ang pinakabatang bilanggo sa bilibid na may angking talino

39. Kumaliwa ka papuntang Masaya Street.

40. Ang pagbasa ng magandang libro ay isang nakagagamot na paraan upang maibsan ang stress.

41. Adopting sustainable agriculture practices can help reduce the environmental impact of food production.

42. Nagbago ang anyo ng bata.

43. Bless you.. tugon ko sa biglang pagbahing nya.

44. Pagkasabi nya nun bigla syang ngumiti agad, Walang bawian.

45. Dalhan ninyo ng prutas si lola.

46. Emphasis is often used to highlight important information or ideas.

47. Naghingi ako ng pahintulot na hiramin ang mga kasangkapan sa kusina para sa aking cooking class.

48. Nakalimutan kong magdala ng lapis sa silid-aralan kaya nagpahiram ako sa aking kaibigan.

49. Nang biglaang magdidilim ang paligid, nahirapan akong makita ang daan pauwi.

50. Ang pagsalungat sa agaw-buhay na sistema ng lipunan ay kailangan upang magkaroon ng tunay na pagbabago.

Recent Searches

matchingnaibibigayutilizamaglinissiyang-siyamalihismaglalaronatinagdinalagooglegawanakitulogtinanggappunong-kahoymahigpitkahaponpadabogpalibhasapaladnangahasnagdiretsosawsawanviewspagkamanghapahahanapzoomagawalubospagkataomagingpanginoonnakakuhapagpilinararapatbalitalalotayomagnakawpaglalabaabenagawainbinibinihawakantsaapramiskasamaadvancenaglaonsesamemakahihigitsinunud-ssunodpagkakatayocigarettesnasuklammatsingcongressallowinggospelhangaringdoingfalljanelalabhannanlilisikpalawanpaslitenviarlabinsiyamkantulongparkegupitipapaputolparahalamanangkasiyahangearkaibangmahiramcarriesnai-dialpinapatapospresence,toolescuelaspopularizebanyovidenskabhoweversuccessnapasubsoblucasshiftdinaluhanpumikitsumasambapagtiisanimaginationsilamapapaubuhinipakitalegislativetshirtlosskumukuhahinihintaynovellesnagpapaniwalaentrypinagkasundosasamahanminutegabingbirdslilypagpanhikberetipooldiningnamamayatmabangiskaninumandespitemagpapapagodorugadiagnoseskahirapaninaantaysparemakisuyohallcharitableestablishumaasacontrolledsumusulatpagkabuhayheijannabagkusseryosongnakaka-inalsohinampastabingsakabaryobabaliknerissalivegracebasedfinishedhindekagayabotantenapawimagdamaganmagdamaglintahojasgenerosityfeltexpresandiamondbecomessandwichearlyoktubrebantulotgowndawbusogkahuluganiiwasanrealditobulongtanawintenderboycomunicandelalalakinghapagmulighedpolvosalas-tresmaestramaghilamosdilawheftymaatimcarriedlintekdepartmentpwedeagam-agamlalake