Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "maubos"

1. Hanggang maubos ang ubo.

Random Sentences

1. Napakabilis ng agaw-buhay na pagbabago sa mundo ng teknolohiya.

2. Kailangan ko munang magpahinga para mawala ang inis ko.

3. Bien que le jeu en ligne puisse être pratique, il est également important de prendre en compte les risques impliqués, tels que la fraude et le vol d'identité.

4. Det har også ændret måden, vi planlægger og styrer vores transport, såsom selvkørende biler og flyvemaskiner med automatisk navigation

5. Don't beat around the bush with me. I know what you're trying to say.

6. La crisis económica produjo una gran inflación que afectó a los precios.

7. Me gusta comprar chocolates en forma de corazón para mi novio en el Día de San Valentín.

8. Pumasok sa sinehan ang mga manonood nang limahan.

9. She was named as one of Time magazine's most influential people in the world in 2016 and 2019.

10. Hindi sadyang nagkaubusan ng pagkain sa aking ref.

11. Les enseignants peuvent encadrer des clubs étudiants pour promouvoir les compétences sociales et artistiques des élèves.

12. Gracias por entenderme incluso cuando no puedo explicarlo.

13. Really? What is he doing sa tapat ng room natin?

14. Ang sugal ay isang problema ng lipunan na dapat labanan at maipagbawal para sa kapakanan ng mga tao.

15. Making large purchases without consulting your budget is a risky move.

16. Ang daming tao sa divisoria!

17. Dumadating ang mga guests ng gabi.

18. In the years following his death, Presley's legacy has continued to grow

19. The beaten eggs are then poured into a heated and greased pan.

20. Ang pagiging malilimutin ni Ana ay laging nagdadala ng problema sa kanilang grupo.

21. Si Aling Juana ang tagalaba ng pamilya.

22. Vivir en armonía con nuestra conciencia nos permite tener relaciones más saludables con los demás.

23. In a small cottage, three little pigs named Peter, Paul, and Percy lived with their mother.

24.

25. In the early days, telephones were connected to a central switchboard, which connected calls manually

26. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

27. Regular grooming, such as brushing and bathing, is important for a dog's hygiene.

28. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

29.

30. Anong klaseng kuwarto ang gusto niya?

31. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

32. Nahulog ang bola sa kanal kaya’t hindi na nila ito nakuha.

33. Me encanta la comida picante.

34. Habang naglalaba, napadungaw siya sa labas at napansin ang magandang paglubog ng araw.

35. They have sold their house.

36. Les travailleurs peuvent travailler dans des environnements différents, comme les bureaux ou les usines.

37. May mga punong-kahoy na nagiging sentro ng mga turista dahil sa kanilang napakalaking sukat at ganda.

38. Magandang umaga po. ani Maico.

39. Tiyak daw na bibili sila ng mga paninda niya.

40. Napakalungkot ng balitang iyan.

41. There are a lot of benefits to exercising regularly.

42. High blood pressure can be managed effectively with proper medical care and self-care measures.

43. Viruses have been used in genetic engineering and biotechnology to develop new therapies and treatments.

44. The patient's doctor recommended a treatment plan based on the type and severity of their leukemia.

45. Heto ho ang isang daang piso.

46. Nag-iisa man siya, hindi siya nawawalan ng pag-asa.

47. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

48. Sa dagat, natatanaw ko ang mga ibon na lumilipad sa malawak na kalangitan.

49. I set my alarm for 5am every day because I truly believe the early bird gets the worm.

50. Ada beberapa tradisi dan kepercayaan terkait kelahiran di Indonesia, seperti menjaga diri dan pola makan selama masa kehamilan.

Recent Searches

tumatawadmauboshjemstedcallingteachstatenatinaginimbitamadalingguidanceklimaayudalabing-siyameffectsmakikikainsipaipipilitfraenhederdahilandaantumingalahinoghinagisbasketballlumangoykumakainkapatawaranpagtatakamasdanhahagospeltig-bebentebisitadisensyohumaloallenangingisaymalapadkisapmatamagtiismatagumpaypaksaperseverance,aalissisikatfakeputolmusicalpresleymakasarilingletterdividesnowginangnapilitangnaka-smirkinfusionesmagpakaramiclientesmakasalanangtawananlaruanjacetiposebidensyaminamahalgabingnewspaperstaosnagbungapaglulutoerlindainaabotdinicampaignsnightbaduynandyannegosyo1929valiosaibinaonmatikmanmatapobrengunti-untiwouldnapatigninpanindagumuhitwonderbecamesayawanganitoparehongdinadasalkasyagabinaglokohanmaghahandahatinggabitabimalambotgisinginihandabadplatformswhymakatulogiosartificialriegatiyaburolkinakainmagtagojosephuritumagalutilizarlangitartisthomeshundredmusicalesaguatuluyanteknologimakasamaipinagbabawaltagalog1980roonbabasahinkonsentrasyonpagkuwaindependentlyautomatiserekassingulangpagpalitpagsahodasawatabaspasswordaregladotagaytaypaglipaskumarimotumupomatayogparurusahansakaypalapitumagalalafeelingbarangaysumabogdreamspookmagagamitmagamotfireworkslarryencounterothers,umikotinilabasmanonoodpagkainlapisbitbitprogramskahongprocesopatienttinungocondohitsurakesorichilanteleviewingoperasyonincluirpilipinogaanoiginawadnaguguluhankaysakasoisinalaysaykapedennakakadalawinternaitinaobmaputiawareevolve