Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "little"

1. Ang Tagaytay ay itinuturing na "Little baguio dahil sa lamig ng klima dito".

2. Don't give up - just hang in there a little longer.

3. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

4. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

5. In a small cottage, three little pigs named Peter, Paul, and Percy lived with their mother.

6. Once upon a time, in a faraway land, there was a brave little girl named Red Riding Hood.

7. The diverse neighborhoods of Los Angeles, such as Chinatown, Little Tokyo, and Koreatown, offer unique cultural experiences and culinary delights.

8. The little boy was happy playing in his sandbox, unaware of the problems of the world - ignorance is bliss when you're that age.

9. The little girl dressed up as a pretty lady for Halloween.

10. The Little Mermaid falls in love with a prince and makes a deal with a sea witch to become human.

11. The Ugly Duckling is a story about a little bird who doesn't fit in until he discovers he's actually a beautiful swan.

12. Then you show your little light

13. Twinkle, twinkle, little star,

14. Twinkle, twinkle, little star.

Random Sentences

1. Nous avons prévu une lune de miel en Italie.

2. Landet er en af de mest velstående i verden, og dette kan tilskrives en række faktorer, herunder en høj grad af økonomisk vækst, en velfungerende arbejdsstyrke og en høj grad af offentlig velfærd

3. Nasa Pilipinas na si Raymond ngayon.

4. Patuloy ako sa paglinga nang may mamataan ang mga mata ko.

5. Araw-araw, nagsasanay si Carlos Yulo ng ilang oras upang mahasa ang kanyang mga skills.

6. spread information and knowledge from one corner of the globe to another.

7. Mathematics can be both challenging and rewarding to learn and apply.

8. Buenas tardes amigo

9. Sadyang mahirap ang pag-aaral ng calculus.

10. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

11. Sa kabila ng mahigpit na bantay, nangahas silang tumakas mula sa kampo.

12. I got a new watch as a birthday present from my parents.

13. Mas maganda ang photoshoot sa dapit-hapon dahil ang ilaw ay nakakapagbigay ng ibang vibe.

14. Al usar un powerbank, es importante seguir las instrucciones del fabricante para un uso seguro y adecuado.

15. I am enjoying the beautiful weather.

16. Certaines personnes sont prêtes à tout pour obtenir de l'argent.

17. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

18. Limitations can be overcome through perseverance, determination, and resourcefulness.

19. Ang sobrang pangamba ay maaaring magdulot ng kakulangan sa kumpyansa sa sarili.

20. Dogs can provide a sense of security and protection to their owners.

21. Me gusta preparar infusiones de hierbas para relajarme.

22. Naghahanap ako ng kailangang gamitin at hinugot ko mula sa baul ang mga ito.

23. Inflation kann auch durch eine Verringerung der Produktion verursacht werden.

24. Elektronisk udstyr kan hjælpe med at forbedre effektiviteten og produktiviteten af ​​virksomheder.

25. Kung papansinin mo'y lagi ka ngang mababasag-ulo.

26. Den danske kirke fejrer påsken med flere forskellige ceremonier i løbet af Holy Week.

27. Ang galing nyang mag bake ng cake!

28. Naging hobby ko na ang paglalaro ng mobile games kaya nahuhumaling ako.

29. Musk has been described as a visionary and a disruptor in the business world.

30. Kumanan kayo po sa Masaya street.

31. Lontong sayur adalah hidangan nasi lontong dengan sayuran dan bumbu yang khas Indonesia.

32. Ang mga salitang mapusok ng kundiman ay naglalarawan ng pagnanasa at pagsisigaw ng pusong umiibig.

33.

34. Hindi maitatago ang hinagpis ng bayan sa pagkamatay ng kanilang minamahal na lider.

35. Retweeting is a feature that allows users to share others' tweets with their own followers.

36. Ano ang binibili namin sa Vasques?

37. Ang kanyang mga salita ay nagbabaga ng inspirasyon sa mga nakikinig.

38. Anong linya ho ang papuntang Monumento?

39. Coffee is a popular beverage consumed by millions of people worldwide.

40. Ano ang pinag-aaralan ni Cora?

41. Dahil sa lockdown ay bumagsak ang ekonomiya ng Pilipinas.

42. Ang mainit na tasa ng tsokolate ay animo'y nagbibigay init sa malamig na gabi.

43. Natakot ang batang higante.

44. La arquitectura de la catedral es sublime, con sus detalles ornamentales y grandiosidad.

45. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

46. Halos hindi niya narinig ang halingling ni Ogor.

47. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

48. A caballo regalado no se le mira el dentado.

49. Walang sinumang nakakaalam, sagot ng matanda.

50. Kehidupan penuh dengan tantangan yang harus dihadapi setiap orang.

Recent Searches

littlepagtutolkulangorganizecarolnararapatmatamanpinalayaslazadamatesanaalisrestawranmakakalacsamanadinanastinitirhancasatupelolegacybritishnataposbilibkayadeletingtinagapananghalianmatapobrenggearnagdaramdamdulotteleviewingfacilitatingweddingyepcigarettereachyuncantopangitdevicesgraphictaastakegenerationerwallettandadedication,sinongmalagoritwalahiteventsdoktormagdakenjidamitstartedsupporttipheftywhichpointthemboybehalfbroadcastsoffentligkulunganpagtangismerlindaperlaanibersaryomagpa-checkupnapakabilisnamtripnapasukoduwendedistancesnapabalitapakilagaylumiitunconstitutionalsarisaringgreatatensyonkulisapkonsultasyontawaeksaytedsubalitmourneddefinitivonationalconnectioncharitablelibrarysumasakaylamesabantulotsonidobumalikhinabolmaunawaannamangcebuopokaraokekabutihantransmitsriskinatupagnanahimikevennagsinekastilahindebalatlender,nagcurvemalikotibinentanewmagkakaanaknag-aalangannanghihinamadnakakapagpatibaynagbabakasyonmagkaibiganpapagalitansabadongpagkakayakappagkakalutonalalaglagnakakabangonmagbibiyahenagpapaigibscottishtanongpaglalabadanakayukonagawangmasayahinculturalinirapannagkapilatnahawakannakasahodmrslibagkasyailoiloibinibigaydiretsahangminamahalmahahalikmagtiwalapinalitannapagtantonapakasipagh-hoypawiinpagkuwanmalulungkotpaghaharutanlalakigalinghandaanmedicinekumalmamagpalagofactoresprincipaleskatutuboskirtnaghilamosnailigtasngumingisicorporationginoongmagalithumihingifranciscohagdanansalaminpinangalananemocionespapalapitnagitlakanilaipinangangakbayaningallehumiganinyongtulongnatulaksinainintaysalatin