Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "solidify"

1. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

Random Sentences

1. The website's contact page has a form that users can fill out to get in touch with the team.

2. Tignan nyo. ngumingisi! May balak yan! Psh.

3.

4. Completing a difficult puzzle or solving a complex problem can create a sense of euphoria.

5. The king's royal palace is his residence and often serves as the seat of government.

6. Tumingin ako sa direksyon kung saan sya nagtatrabaho...

7. Linggo ng umaga at ang palengke ay siksikan.

8. Mathematics provides a systematic and logical approach to problem-solving.

9. I used my credit card to purchase the new laptop.

10. Nagtitinginan na sa amin yung mga tao sa paligid namin.

11. Das Gewissen ist ein wichtiger Faktor bei der Entscheidungsfindung in schwierigen Situationen.

12. Alors que certaines personnes apprécient le jeu comme passe-temps ou forme de divertissement, il peut également conduire à la dépendance et à des problèmes financiers.

13. The Tesla Roadster, introduced in 2008, was the first electric sports car produced by the company.

14. Hindi ko maintindihan kung bakit kailangan pang magmangiyak-ngiyak dahil sa mga simpleng bagay.

15. The pretty lady at the store helped me find the product I was looking for.

16. Disyembre ang paborito kong buwan.

17. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

18. Some kings have been known for their military conquests, such as Alexander the Great and Napoleon Bonaparte.

19. May tawad. Sisenta pesos na lang.

20. Es importante ser conscientes de nuestras acciones y cómo pueden afectar a los demás.

21. Don't cry over spilt milk

22. Habang nakaluhod, dalawang kamay niyang tinutop ang pisngi.

23. Huwag kang maniwala dyan.

24. Bis morgen! - See you tomorrow!

25. LeBron James is a dominant force in the NBA and has won multiple championships.

26. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

27. Banyak pemilik kucing di Indonesia juga menjaga kebersihan kandang atau tempat tinggal kucing mereka.

28. Malaya na ang ibon sa hawla.

29. Yumabong ang pagpapahalaga sa kalusugan ng mga tao dahil sa mga kampanya para sa mga aktibidad sa fitness.

30. Nagitla ako nang biglang bumagsak ang mga plato sa kusina.

31. Football is a popular team sport that is played all over the world.

32. Ang pagtitiyak ng seguridad sa mga border at mga pantalan ay mahalaga upang maiwasan ang pagpasok ng mga illegal na droga sa bansa.

33. Napalayo ang talsik ng bola nang ito’y sipain ni Carlo.

34. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

35. Lumiwanag ang mukha ni Ana nang makita ang resulta ng exam.

36. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

37. May salbaheng aso ang pinsan ko.

38. Ang lolo at lola ko ay patay na.

39. Hindi importante kung maganda o pangit ang itsura, ang mahalaga ay hindi kababawan ng kalooban.

40. Uuwi na ako, bulong niya sa sarili.

41. Sa kalawanging medya-agwa niyon ay nakasilong ang iba pang agwador.

42. Patuloy pa rin ang paghalik ng butiki sa lupa tuwing dapit-hapon.

43. Dahil sa kanyang pagka-suway, si Carla ay napag-initan ng kapwa niya empleyado.

44. Skolegang er en vigtig del af børns opvækst og udvikling.

45. Comer alimentos frescos y no procesados puede ayudar a reducir el riesgo de enfermedades cardíacas y diabetes.

46. It's not worth getting worked up over - it's just a storm in a teacup.

47. El actor hizo un comentario controversial que está llamando la atención de los medios.

48. Hallo! - Hello!

49. El orégano es una hierba típica de la cocina italiana, ideal para pizzas y pastas.

50. Ang kanta ay isinulat ukol kay Alice na kaniyang sinisinta

Recent Searches

returnedfuturesolidifytechnologyflashnakaupodipangproblemalalakinalugmokisdangbinibiyayaaninferioresinomalexandergumisingencounterlagnatpapuntanghalikakamustaspellingbarongpopcornonetaingaaffiliateyoutubeyumakapgandanami-missbinibiliumanoganitosamakatwidbilangclientsultimatelypakibigyaniatfipapaputolasoarguedahanpinakamahalagangrosariotumakastaga-hiroshimasulyappanalanginatensyongsunud-sunurantamanakatunghaykinatatakutanikinakagalitgobernadornangagsipagkantahankakilalamuliplantaskonsultasyonpagsalakaykapatawarannapapatungomakakawawaartistaskabundukanmakapalagnagpagupitkapamilyanamumutlanakayukomensajessumusulatkapatagannaabotnagdalaisusuotnakaakyatkatolisismonaalisrektangguloalapaapnanunuripuntahanhanapbuhaymagkasamamagpapigilnahigitandadalawcualquiermarketingnanalopakinabanganmakawalaagostoibilimakakainiangatporgatasbinitiwankambingmatikmanpnilitmariemagsimulasagotpinilitself-defensehotelkendilunesestategigisingtomorrowsiniyasatpayginoomatipunobagamatburdendagatnaggingisinakripisyoformisamamulighederrenatoangaldesarrollartsuperdasalhappenedbingowalongkingdomipantalopiyanvistroselleseeknagtatakamaitimdagabumahamaskmalldiamondsorrytenipinabalikabenepasyaotraswidespreadnewsellenmatabapinunitbelieveddaangumantimind:itloginternetpossiblemapapasedentarydumatingtwotoolelectnegativegotsomekitydelsercomputerprogramming,formswindowshiftoverallmalalimmagnanakawnangahastumalonnagpasyanananalohimutokstockspaghihirapalaalamatigashanap-buhayconectadoszoomdiseases