Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "have"

1. "Dogs are like potato chips, you can't have just one."

2. A father's love and affection can have a significant impact on a child's emotional development and well-being.

3. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

4. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

5. Advances in medicine have also had a significant impact on society

6. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

7. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

8. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

9. All these years, I have been blessed with experiences that have shaped me into the person I am today.

10. All these years, I have been blessed with the love and support of my family and friends.

11. All these years, I have been building a life that I am proud of.

12. All these years, I have been chasing my passions and following my heart.

13. All these years, I have been cherishing the relationships and connections that matter most to me.

14. All these years, I have been creating memories that will last a lifetime.

15. All these years, I have been discovering who I am and who I want to be.

16. All these years, I have been grateful for the journey and excited for what the future holds.

17. All these years, I have been grateful for the opportunities that have come my way.

18. All these years, I have been inspired by the resilience and strength of those around me.

19. All these years, I have been learning and growing as a person.

20. All these years, I have been learning to appreciate the present moment and not take life for granted.

21. All these years, I have been making mistakes and learning from them.

22. All these years, I have been overcoming challenges and obstacles to reach my goals.

23. All these years, I have been reminded of the importance of love, kindness, and compassion.

24. All these years, I have been striving to be the best version of myself.

25. All these years, I have been striving to live a life of purpose and meaning.

26. All these years, I have been surrounded by people who believe in me.

27. All these years, I have been working hard to achieve my dreams.

28. All these years, I have been working to make a positive impact on the world.

29. Arabica beans are generally considered to be of higher quality and have a milder flavor.

30. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

31. At have en klar samvittighed kan hjælpe os med at træffe de rigtige beslutninger i pressede situationer.

32. At have en sund samvittighed kan hjælpe os med at opretholde gode relationer med andre mennesker.

33. At have en træningsmakker eller træningsgruppe kan hjælpe med at øge motivationen og fastholde en regelmæssig træningsrutine.

34. At have et håb om at blive en bedre person kan motivere os til at vokse og udvikle os.

35. At have håb om at gøre en forskel i verden kan føre til store bedrifter.

36. At have håb om en bedre fremtid kan give os troen på, at tingene vil blive bedre.

37. At have håb om, at tingene vil ordne sig, kan hjælpe os med at se lyset i slutningen af tunnelen.

38. At tage ansvar for vores handlinger og beslutninger er en del af at have en god samvittighed.

39. At tilgive os selv og andre kan være afgørende for at have en sund samvittighed.

40. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

41. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

42. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

43. Baby fever is a term often used to describe the intense longing or desire to have a baby.

44. Børn bør have adgang til sunde og næringsrige fødevarer for at sikre deres sundhed.

45. Børn bør have adgang til uddannelse og sundhedsydelser uanset deres baggrund eller socioøkonomiske status.

46. Børn bør have tid og plads til at lege og have det sjovt.

47. Børn skal have mulighed for at udforske og lære om verden omkring dem.

48. Børn skal have mulighed for at udtrykke sig og udvikle deres kreative evner.

49. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

50. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

51. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

52. Cancer research and innovation have led to advances in treatment and early detection.

53. Cancer treatment can have side effects, such as nausea, hair loss, and weakened immune system.

54. Cars, airplanes, and trains have made it possible for people to travel great distances in a relatively short amount of time

55. Cheating can have devastating consequences on a relationship, causing trust issues and emotional pain.

56. Children's safety scissors have rounded tips to prevent accidental injuries.

57. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

58. Coffee shops and cafes have become popular gathering places for people to socialize and work.

59. Det er vigtigt at have en forståelse af sandsynligheder og odds, når man gambler.

60. Det er vigtigt at have en kompetent og erfaren jordemoder eller læge til stede under fødslen.

61. Det er vigtigt at have en positiv indstilling og tro på sig selv, når man bliver kvinde.

62. Det er vigtigt at have et godt støttenetværk, når man bliver kvinde.

63. Det er vigtigt at have et støttende netværk af venner og familie under fødslen og i de første måneder efter fødslen.

64. Det er vigtigt at have gode handelsrelationer med andre lande, hvis man ønsker at eksportere succesfuldt.

65. Det er vigtigt at have relevant erfaring, når man søger en ny jobposition.

66. Different religions have different interpretations of God and the nature of the divine, ranging from monotheism to polytheism and pantheism.

67. Dogs have a keen sense of smell and are often used in law enforcement and search and rescue operations.

68. Du behøver ikke at skynde dig så meget. Vi har masser af tid. (You don't need to hurry so much. We have plenty of time.)

69. Economic recessions and market crashes can have devastating effects on investors and the broader economy.

70. Efter fødslen kan der være en følelse af lettelse og glæde over at have en ny baby.

71. Efter fødslen skal både mor og baby have grundig lægeundersøgelse for at sikre deres sundhed.

72. Einstein's contributions to science have had significant implications for our understanding of the universe and our place in it.

73. Einstein's writings on politics and social justice have also had a lasting impact on many people.

74. Electric cars can have positive impacts on the economy by creating jobs in the manufacturing, charging, and servicing industries.

75. Electric cars can help reduce air pollution in urban areas, which can have positive impacts on public health.

76. Electric cars have a lower center of gravity, which can improve handling and stability.

77. Electric cars have lower fuel costs than gasoline-powered cars since electricity is generally cheaper than gasoline.

78. Electric cars have lower maintenance costs as they have fewer moving parts than gasoline-powered cars.

79. Electric cars may have a higher upfront cost than gasoline-powered cars, but lower operating and maintenance costs can make up for it over time.

80. Embroidery scissors have pointed tips and small blades for intricate cutting in sewing and embroidery work.

81. Environmental protection can also have economic benefits, such as creating jobs in sustainable industries.

82. Erfaring har vist mig, at det er vigtigt at have en positiv tilgang til arbejdet.

83. Every year on April Fool's, my dad pretends to have forgotten my mom's birthday - it's a running joke in our family.

84. Every year, I have a big party for my birthday.

85. Facebook Messenger is a standalone messaging app that allows users to have private conversations with friends and contacts.

86. Fødslen kan tage lang tid, og det er vigtigt at have tålmodighed og støtte.

87. Football players must have good ball control, as well as strong kicking and passing skills.

88. Foreclosed properties are homes that have been repossessed by the bank or lender due to the homeowner's inability to pay their mortgage.

89. Foreclosed properties can be a good investment opportunity for those who have the time and resources to manage a rental property.

90. Foreclosed properties may be sold in as-is condition, which means the buyer may have to make repairs or renovations.

91. Foreclosed properties may have a lot of competition from other buyers, especially in desirable locations.

92. Foreclosed properties may have back taxes or other outstanding debts, which the buyer may be responsible for paying.

93. Foreclosed properties may have liens or other encumbrances, which can complicate the purchase process.

94. Forgiving someone doesn't mean that we have to trust them immediately; trust needs to be rebuilt over time.

95. Gambling kan have negative konsekvenser for en persons mentale og fysiske sundhed, samt deres relationer og økonomiske situation.

96. Hairdressing scissors, also known as shears, have different blade designs for different cutting techniques.

97. Happy birthday to my best friend, I hope you have a wonderful day!

98. Have they finished the renovation of the house?

99. Have they fixed the issue with the software?

100. Have they made a decision yet?

Random Sentences

1. Habang nagluluto, nabigla siya nang biglang kumulo at sumabog ang kawali.

2. Ang mga pangarap natin ay nagbibigay sa atin ng inspirasyon upang magtrabaho nang husto.

3. Bawal magpakalat ng mga fake products dahil ito ay nagdudulot ng kawalan ng seguridad sa kalusugan at kaligtasan ng mga mamimili.

4. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

5. She has written five books.

6. Athena.. gising na. Uuwi na tayo maya maya.

7. Ang pagkapanalo ng koponan ay siyang ikinagagalak ng lahat ng sumuporta sa kanila.

8. Mangiyak-ngiyak siya.

9. Kapitbahay ni Armael si Juang malilimutin.

10. Inalala nila ang mga aral na itinuro ng misyunero tungkol kay Kristo.

11. Oscilloscopes display voltage as a function of time on a graphical screen.

12. Our transport systems-diesel-run railways, steamships, motor vehicles, and aeroplanes-all constantly need natural fuel to keep on moving

13. I just launched my new website, and I'm excited to see how it performs.

14. Malapit na naman ang eleksyon.

15. Supreme Court, is responsible for interpreting laws

16. Hindi lahat ng tao ay bukas palad, kaya kailangan mong mag-ingat sa mga taong pwede kang masaktan.

17. Pinagpalaluan si Maria ng kanyang mga kapatid dahil sa kanyang sipag at tiyaga.

18. Kehidupan penuh dengan tantangan yang harus dihadapi setiap orang.

19. Malaya na si Jerry matapos itong makulong ng limang taon.

20. Ang aming angkan ay may malaking bahagi ng kasaysayan ng aming bayan.

21. Pinabulaanang muli ito ni Paniki.

22. Holy Week markerer også starten på foråret og den nye vækst efter vinteren.

23. Ang mga magulang niya ay pinagsisikapan ang magandang kinabukasan ng kanilang mga anak.

24. Oo nga babes, kami na lang bahala..

25. Oo naman. I dont want to disappoint them.

26. I heard that he's not trustworthy, so I take everything he says with a grain of salt.

27. Sa gitna ng paglalakad sa kalsada, huwag magpabaya sa kaligtasan at sumunod sa mga traffic rules.

28. He bought a series of books by his favorite author, eagerly reading each one.

29. This has led to increased trade and commerce, as well as greater mobility for individuals

30. El amor todo lo puede.

31. Un powerbank es un dispositivo portátil que permite cargar dispositivos electrónicos.

32. Tila ngayon ko lang napansin ang kwebang ito.

33. The Constitution of the United States, adopted in 1787, outlines the structure and powers of the national government

34. Sa kultura ng mga Igorot, mahalaga ang punong-kahoy dahil ito ang ginagamit sa kanilang mga ritwal.

35. Ang bayanihan ay nagbibigay inspirasyon sa aming mga kabataan na maging aktibo at maging bahagi ng komunidad.

36. Cancer can impact not only the individual but also their families and caregivers.

37. Hinde ko dala yung cellphone ni Kenji eh.

38. Microscopes can also be used to analyze the chemical composition of materials, such as minerals and metals.

39. Women have a higher life expectancy compared to men, on average.

40. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

41. Hospitalization is the process of being admitted to a hospital for medical treatment or observation.

42. Oscilloscopes can be connected to a computer or network for data logging, remote control, and analysis.

43. Kailangan natin ng mga kubyertos para makakain ng maayos.

44. Kahit nasa gitna ng kainan, siya ay tulala at parang may iniisip.

45. Ang kaniyang ngiti ay animo'y nagbibigay-liwanag sa madilim na kwarto.

46. Kapag nawawala ang susi, sinasalat niya ang bawat bulsa.

47. Maraming guro ang nagbigay ng suhestiyon ukol kay Beng.

48. Dapat pa nating higpitan ang seguridad ng establisimyento, mungkahi naman ng manager.

49. Ngunit hindi inaasahang ang dadalaw pala sa kanya ay ang kanyang ama

50. He collects stamps as a hobby.

Similar Words

Echave

Recent Searches

havepagkaraanvillagekahitmasungiteskwelahanhopeyou,tag-arawpalengkediliginpinisillakadmahiwagangaywanyayainiswouldbantulothojasejecutanroongumagalaw-galawparkingtechnologicalintelligenceknowmundoumiiyakcomplexmagtrabahoglobalmuligtnaglabanegro-slavespinakamaartengjobskumulogdakilangnakilalatibokdamitpilipinaspinag-aralanstopdiferentesparttinangkapinagpapaalalahanannaghubaddurasbalotnagkakasyapedediagnosessobrapeeppepelabanannagkasakitmataliksemillaswikamag-uusapespecializadaspinalayaspamangkinislapinagawapagkakayakapmatalimnalagpasansayawansongskasalkasawiang-paladexecutiveikinabitnohgamitmaglalabingkumampirepresentativesnewnaiinishigabawianpagtataposkalabawlolotonyokaharianalinsiyang-siyabroadlumagonakinignakasusulasokpaboritongnangyayarisumindikaninatrainsiyonsanakutsaritangmuntingmarylabing-siyamaraw-arawpagtuturokinamumuhianpogiagawumalissanangrelativelymaghatinggabidumagundongmisyunerongipinabalikmakabilitinikmanthanksgivingngunitlazadanakikitanatuyopasyenteumibigiba-ibangginawaranbangkotigaswaldomaaaritelebisyonmanuelmuntinlupapaparusahanmasdanfarallbigmagpaliwanagtumawagpasyanightpagkainislarongbumaligtadnanlilisiktumingindiyankinagabihansumamaflamencoproducts:niyamakahiramisinalaysayautomationbestfrienddalanghitakumalataftertinigenglandintindihindekorasyonipinagdiriwangheartpananimencuestasmedidamournedpagsubokplatobairdpagbebentakailanganhahatolkombinationkonekikinakatwiranmahalagapulisandamingcanteencareskillsulingkapamilyanagtalunanpalapag-aalalat-shirttutoringtamangsurroundings