Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "entrance"

1. Nandito ako sa entrance ng hotel.

Random Sentences

1. Walang tutulong sa iyo kundi ang iyong pamilya.

2. The cake you made was absolutely delicious.

3. The invention of the telephone led to the creation of the first radio dramas and comedies

4. Les entreprises cherchent souvent à maximiser leurs profits.

5. Saka na yun, pag fiance ko na sya saka ko sya liligawan!

6. Los alimentos ricos en calcio, como los productos lácteos y el tofu, son importantes para la salud ósea.

7. Nakita niya ang isang magandang babae sa kaniyang harapan.

8. This has led to increased trade and commerce, as well as greater mobility for individuals

9. Naidlip siya at nang magising, nakita niya ang magandang dilag.

10. Gutom ako kasi hindi ako kumain kanina.

11. Sweetness is a sensation associated with the taste of sugar and other natural and artificial sweeteners.

12. Gusto rin nilang patunayan kung siya nga ay magaling tulad ng napabalita.

13. Nag-aabang sa langit, sa mga ulap, sumisilip

14. The United States is the third-largest country in the world by land area and the third most populous country in the world.

15. Electric cars are part of a larger movement toward sustainable transportation, which includes public transportation, biking, and walking, to reduce the environmental impacts of transportation.

16. Hindi maganda ang epekto ng laging pagmamangiyak-ngiyak dahil ito ay maaaring maging dahilan ng depresyon at iba pang mental health issues.

17. She's always creating drama over nothing - it's just a storm in a teacup.

18. Ang gusto sana namin ay dalawang double beds.

19. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

20. Tatanggapin ko po ang anumang kaparusahan.

21. Hindi sang ayon si Magda sa mga sinabi ni Mariel.

22. Higupin mo muna ang sabaw bago kainin ang noodles.

23. Ang pasya nang pagkapanalo ay sa tela ng matanda.

24. Hindi ako sang-ayon sa pamamaraan na ginagamit mo upang maabot ang iyong mga layunin.

25. Después de la cena, nos sentamos a conversar en el jardín.

26. Mange mennesker deltager i påsketjenester i kirkerne i løbet af Holy Week.

27. Wala siyang ginagawa kundi ang maglinis ng kanyang bakuran at diligin ang kanyang mga pananim.

28. Sa kanyang hinagpis, tahimik na pinahid ni Lita ang luhang pumapatak sa kanyang pisngi.

29. Eine Inflation von 2-3% pro Jahr wird oft als normal angesehen.

30. The Tortoise and the Hare teaches a valuable lesson about perseverance and not underestimating others.

31. Sa kasalukuyan, marami ang may agam-agam sa kalagayan ng ating bansa sa gitna ng pandemya.

32. The internet is full of fashion blogs. They're a dime a dozen.

33. Inalagaan niyang mabuti ang halaman at tinawag itong Pinang, Sa palipat-lipat sa bibig ng mga tao ang pinang ay naging pinya.

34.

35. Ein frohes neues Jahr! - Happy New Year!

36. Cultivar maíz puede ser un proceso emocionante y gratificante, con una buena planificación y cuidado, se puede obtener una cosecha abundante

37. George Washington was the first president of the United States and served from 1789 to 1797.

38. But in most cases, TV watching is a passive thing.

39. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

40. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

41. I have been working on this project for a week.

42. Hindi natin dapat husgahan ang mga tao base sa kanilang kababawan dahil maaaring mayroon silang malalim na dahilan.

43. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

44. Her album Thank U, Next was a critical and commercial success, debuting at number one on the Billboard 200 chart in 2019.

45. Lazada is headquartered in Singapore and has operations in Indonesia, Malaysia, the Philippines, Singapore, Thailand, and Vietnam.

46. I wasn't supposed to tell anyone about the surprise party, but I accidentally let the cat out of the bag to the guest of honor.

47. Da Vinci fue un pintor, escultor, arquitecto e inventor muy famoso.

48. Mayroong nakawan sa bahay namin kahapon, pero aksidente namin naabutan ang mga magnanakaw.

49. Muchas personas disfrutan tocando instrumentos musicales como hobby.

50. Ininom ni Henry ang kape sa kusina.

Recent Searches

entrancedivisionmakitangatingtaonnami-misshayaannapapahintokilonginabutankinumutanenviartinahaktatanggapinalapaapdesisyonaniwananpapayainhalepaparusahangawaingpatakbongmaaaringmasungitfavorjulietbagamagawaumibigpag-aalalanapapikitmandirigmangbutterflyumabotbilihinartetsssmaatimmaphowevertinitirhandiyoshomeshitnaroonfonomalambingadverseparineatitsernatanggapinantokpolooueatentopumuntarevolutionizedtoothbrushnakakapamasyalbastacomputere,kundimannamumutlapanginoonbumagsakfollowedlabishindesenadornagdaosmarilounaalisakongtawapakainintinungoplatformsteamdiagnosticmapaibabawbilugangiatfiniinomwaripisngisumusulatprodujolinggongtawadlugarnakakabangonmakapangyarihanpaghaharutaniloilopanalanginnagpipikniknagsunuranracialdecreasedkarapatangguerreroautomatiskpagsayadtignaneducationkarangalanshinesteachermatamanisinamapagsusulitmaskinereksport,sumasakaysusihundredsinakopmagnifytasapalaydyipinantaybesthuwebessakakinamumuhianhistorykaguluhannitongfeedback,namfueespigasexcusenamumukod-tangielvisbook:nyechoicepagekuneleukemiafurystonehamdamitsoonsourcesofficebluemovingfatalvasquesdaigdigpartnerfuturewithoutbilingclientereadwhichservicestechnologiestelevisedrecentmrsprotegidohanapinpalakainiisipkuwartaalasmukhapalayansalbahehangaringpatulogeksenalumibotforcesagilitysumasayawteachdahilkwenta-kwentapamburaobra-maestranaglalatanglumalangoynananaloerlindanagkwentot-shirtnakakagalakakuwentuhanlibangankahariannakikianamumulotnangyari