Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "entrance"

1. Nandito ako sa entrance ng hotel.

Random Sentences

1. Kailangan nating magbasa araw-araw.

2. Pagkatapos ay abut-abot ang kanyang paghingi ng paumanhin sa mga duwende.

3. Bumibili ako ng malaking pitaka.

4. Effective use of emphasis can enhance the power and impact of communication.

5. Ang tubig-ulan ay tumutukoy sa ulan na mayaman sa tubig at mahabang tagal.

6. In 1977, at the age of 42, Presley died of a heart attack

7. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

8. Si mommy ay matapang.

9. Las personas pobres a menudo carecen de recursos para protegerse de desastres naturales y crisis.

10. The team's success and popularity have made the Lakers one of the most valuable sports franchises in the world.

11. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

12. Yumabong ang mga negosyo na mayroong social media presence dahil sa kanilang pagkakaroon ng mas malawak na market.

13. Jouer de manière responsable et contrôler ses habitudes de jeu est crucial pour éviter des conséquences graves.

14. Natutuwa ako sa pag-aalaga ng mga halaman kaya nahuhumaling ako sa pagtatanim.

15. Tumigil muna kami sa harap ng tarangkahan bago pumasok sa simbahan.

16. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

17. Sa pagpaplano ng kasal, kailangan isaalang-alang ang oras ng seremonya upang hindi maabala ang mga bisita.

18. A wedding planner can help the couple plan and organize their wedding.

19. El internet ha cambiado la forma en que las empresas interactúan con sus clientes.

20. Ahhh...wala! Bakit ba, nagdadasal ako noh!

21. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

22. Mag-usap tayo sa WhatsApp o Line.

23. Bakit sila nandito tanong ko sa sarili ko.

24. Tantangan hidup dapat muncul dalam berbagai bentuk, baik dalam bidang pribadi, profesional, atau emosional.

25. Ano ang isinusuot ng mga estudyante?

26. He's known to exaggerate, so take what he says with a grain of salt.

27. They have been renovating their house for months.

28. Cancer is caused by a combination of genetic and environmental factors, such as tobacco use, UV radiation, and exposure to carcinogens.

29. Gusto kong matutong tumugtog ng gitara.

30. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

31. God is a concept of a supreme being or divine force that is often worshiped and revered by religious communities.

32. Sinabi naman ni Apollo ang mga dapat gawin.

33. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

34. La rotación de cultivos es una práctica agrícola que ayuda a mantener la salud del suelo.

35. Naging hobby ko na ang paglalaro ng mobile games kaya nahuhumaling ako.

36. Pinaliguan ni Simon ang sanggol.

37. Naging masyadong mayabang ang bata at nararapat daw itong parusahan.

38. Ipanlinis ninyo ng sahig ang walis.

39. Napakagaling nyang mag drowing.

40. Tinanong ang kanyang ina kung nasaan ito.

41. Palibhasa ay madalas na nagkakaroon ng mga insights sa mga bagay na hindi pa naiisip ng ibang mga tao.

42. The political campaign gained momentum after a successful rally.

43. Climate change is one of the most significant environmental challenges facing the world today.

44. Born in Tupelo, Mississippi in 1935, Presley grew up listening to gospel music, country, and blues

45. Con paciencia y dedicación, se puede disfrutar de una deliciosa cosecha de maíz fresco

46. His presidency was marked by controversy and a polarizing political climate.

47. Ang kanyang presensya sa aming pagtitipon ay lubos naming ikinagagalak.

48. Papuntang Calamba ang dilaw na bus.

49. The city hosts numerous cultural festivals and events, celebrating different traditions and communities throughout the year.

50. Limitations are the boundaries or constraints that restrict what one can or cannot do.

Recent Searches

entranceniyonkinalakihanpagsagotasignaturanagagamitpumilimakapagempakemarurumikidkiranmakatulogtumatanglawdiwatahayaanyumabangjingjingculturasiiwasantilgangnagbagonagdalanakitulogkumampikilongkagubataninagawnatabunansenadorkalupifavorkanayangkaninainlovenationalmaluwagkabighamantikamalalakiumiwasnaiiniscover,inangbumotomoneymalasutlanagdaoskutsaritangpangakopaggawakumapitipinansasahoglaganapeconomicnilayuanshadesmaranasanbathalapusasapotmaistorbosineathenasisidlannakatinginkuwebareynaestatenaturalforståmarieheartbeatbusymejoanitokingdomdangerousaksidentekarapataniniibigshineskatagavetoherramientarisenapapahintomananaigumingitnatanggapiloggivewordmabilisailmentstwitchhitikdipangcellphonetradebusogpaki-ulitsparksumusunolarryeeeehhhhbilhinproperlywidespreadnitongmaskbinabalikdawsakinearnditodinikasinggandayoungbridelivematabaproducirhallcongratsreservednaritolinerealpublishedsteertiposlimitfredmonetizingreadingoftesingerbulaexitalininilingnagbabagameronmustpagkaguiltyumigtadnananalongpinalambotampliahinintaypinagpalaluanninyongedsawaringagilatumingalanagtalunanmahigitenterrangeintelligenceprogramming,nagkakakainbroadcastingseparationprotestamitigatemapstreaminghapdimagbubungasambitmatutoatindadalawinnakangangangtiyakanespadapahirapanitinalikawili-wilimakasilongisusuotarkilajemidadiskedyulnakaka-bwisiticonswideduontiptraditionallalabasmahulogpagkalitolaptopilocoskinsenagpasama