Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "ganapin"

1. Tuwing mayo kung ganapin ang eleksyon.

Random Sentences

1. La motivation est un élément clé de la réussite, car elle permet de maintenir un niveau d'engagement élevé dans l'accomplissement d'un objectif.

2. Det er også vigtigt at sætte et budget og begrænse sin risiko for at undgå at miste mere end man har råd til.

3. Maya-maya lang, nagreply agad siya.

4. Pneumonia can be life-threatening if not treated promptly.

5. Ang pagpapakain ng mga biko at tikoy ay isa sa mga tradisyonal na gawain tuwing Chinese New Year.

6. Børn skal have mulighed for at udtrykke sig og udvikle deres kreative evner.

7. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

8. Opo. Iiwasan ko po si Anthony. putol ko sa sinasabi niya.

9. El equilibrio entre la ingesta de calorías y la actividad física es importante para mantener un peso saludable.

10. Ang marahas na pag-atake ay labag sa batas at maaaring magdulot ng malubhang parusa.

11. Women have a higher life expectancy compared to men, on average.

12. Ako ay nanatili sa iyong pagkatao subalit nagpadala ka mga pagsubok.

13. Mi amigo y yo nos conocimos en el trabajo y ahora somos inseparables.

14. Mi aspiración es ayudar a los demás en mi carrera como médico. (My aspiration is to help others in my career as a doctor.)

15. En helt kan være enhver, der har en positiv indflydelse på andre mennesker.

16. Las labradoras son excelentes perros de trabajo y se utilizan a menudo en búsqueda y rescate.

17. Ang pagtitiyaga sa pagbabayad ng utang ay magdudulot ng kapanatagan sa buhay at magpapalakas ng financial stability.

18. Then the traveler in the dark

19. Sa bawat pagkakamali, mayroong aral na pwedeng matutunan, samakatuwid.

20. Kapag ang puno ay matanda na, sa bunga mo makikilala.

21. En invierno, las personas disfrutan de bebidas calientes como el chocolate caliente y el té.

22. Ang pagkakaroon ng sariling realidad na hindi nakabatay sa mga katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

23. Don't worry about making it perfect at this stage - just get your ideas down on paper

24. El parto puede ser natural o por cesárea, dependiendo de las circunstancias y la salud de la madre y el bebé.

25. Nagluluto si Tess ng spaghetti.

26. Napahinto siya sa pag lalakad tapos lumingon sa akin.

27. Many fathers have to balance work responsibilities with family obligations, which can be challenging but rewarding.

28. Rebuilding trust and repairing a relationship after cheating can be a difficult and lengthy process that requires communication, commitment, and forgiveness from both partners.

29. Ang mga pangarap ay nagbibigay sa atin ng direksyon upang magkaroon ng layunin sa buhay.

30. Ako'y lumilipad at nasa alapaap na.

31. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

32. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

33. Nagtapos sya sa unibersidad ng Pilipinas.

34. La salsa de habanero es muy picante, asegúrate de no agregar demasiado.

35. Limitations can be a result of fear or lack of confidence.

36. ¿Dónde está el baño?

37. Dumadating ang mga guests ng gabi.

38. Las heridas en la cara o cerca de los ojos deben ser evaluadas y tratadas por un especialista en oftalmología.

39. All these years, I have been reminded of the importance of love, kindness, and compassion.

40. Computer vision is another field of AI that focuses on enabling machines to interpret and analyze visual data.

41. Il est important de savoir gérer son argent pour éviter les problèmes financiers.

42. She is not drawing a picture at this moment.

43. Butterfly, baby, well you got it all

44. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

45. Ayaw niyang kumampi sa matatalo kung kaya't ang ginawa niya ay nagmasid-masid muna ito sa di kalayuan at pinanood ang nagaganap na labanan.

46. Kailangan natin ng mga kubyertos para makakain ng maayos.

47. La tos nocturna puede ser un síntoma de enfermedades respiratorias como el asma y la apnea del sueño.

48. Crush kita alam mo ba?

49. Some countries have abolished the monarchy, while others continue to have kings or other types of monarchs.

50. The power of a single act of kindness can be immeasurable in its impact.

Recent Searches

interests,ganapinkagabipagiisipkailanmantitiralasapalapagnandiyanpublicationfe-facebookkasuutanhvordanfauxfulfillingnatandaanibigorugaalexandersumindicommissionjackzdahonngpuntagabetwinkleneroeveningpatrickincreasesheftysarilinalungkotmagpahabanag-away-awaymagkakaanaknakahigangnagmamadalipaanongaktibistabuenamakatatlotitamedicalnapakalusogsteamshipsnaaksidentenagmumukhathoughtsbahagyangpromiseinastasetyembrehinigitkiniligdiagnosescomunicanharinglimosboksingaalisnegosyoinformedhassecarsekaharianclaranagliwanagbinibiyayaanobra-maestrauugud-ugodkapasyahanamericahoneymoonabut-abothihigitsabonggospelhawakmakausappakibigaytagtuyotagawapatnapumataaaspulongnaiwangmayamangtrainspersonejecutanso-calledpangangatawannagbibigayanplantarmagpapabunotpunongkahoyvetonoonmatabangbinawimaskitrencigarettesbriefagamichaelonceoverviewlibroreturnedinvolvebumibilinakayukokarunungandollarh-hoynanunurirektanggulocultivationmatumalnahigitanmakipagkaibigantumindigagostokwebabilaoitinulostayocandidatesmatikmanaraw-dumaloiniintaymulighedermabilis1787maitimpakainmapapaprobablementeprogramming,itlogworkdayanotherexplainlabasngayontanghalipaghangakasalhayaangmayabangpare-parehomusicalnagsusulatnamulaklakbarung-barongmumuranakapapasongkapangyahiranpagkabiglanagdaraannakangisinasasakupanmatariknakagalawmakakabalikvillagemakatulogpwestoplantasmabagalaayusinsiyudadminervielumakidisenyongdiscouragedpusopokervegashinahaplossilyamaliitsalitangtulanggumagawapatianitomarangyangginawabilhintryghedadangmournedtuwidconcernssutilk-drama