Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

72 sentences found for "anong"

1. Ahh Mommy, anong oras ba yung flight mo? tanong ni Maico.

2. Ang kanilang pagmamahalan ay animo'y walang hangganan, kahit sa anong pagsubok na dumaan.

3. Ang snob naman neto. Alam mo ba kung anong oras na?

4. Anong award ang pinanalunan ni Peter?

5. Anong bago?

6. Anong buwan ang Chinese New Year?

7. Anong gamot ang inireseta ng doktor?

8. Anong ginagawa mo? nagtatakang tanong ko.

9. Anong ginagawa mo?! mataray pang sabi nito.

10. Anong ginawa nya sayo? Sya ba nagpaiyak sayo?

11. Anong gusto mo? pabulong na tanong saken ni Maico.

12. Anong hindi? Eh pulang-pula ka na oh!

13. Anong kailangan mo? pabalang kong tanong.

14. Anong karangalan ang ibinigay sa kanya?

15. Anong klaseng adobo ang paborito mo?

16. Anong klaseng karne ang ginamit mo?

17. Anong klaseng kuwarto ang gusto niya?

18. Anong klaseng sinigang ang gusto mo?

19. Anong kubyertos ang hiningi ni Maria?

20. Anong kulay ang gusto ni Andy?

21. Anong kulay ang gusto ni Elena?

22. Anong kulay ang gusto ni Merlinda?

23. Anong linya ho ang papuntang Monumento?

24. Anong lugar ang pinangyarihan ng insidente?

25. Anong nakakatawa? sabay naming tinanong ni Sara

26. Anong nangyari sa iyo? Bakit ang tagal mong nawala?

27. Anong nangyari sayo? Bakit hinde ka nagkakakain?

28. Anong nginingisi ngisi mo dyan! May balak ka eh! Ano yun?!

29. Anong oras ako dapat umalis ng bahay?

30. Anong oras gumigising si Cora?

31. Anong oras gumigising si Katie?

32. Anong oras ho ang dating ng jeep?

33. Anong oras mo ako ihahatid sa airport?

34. Anong oras mo gustong umalis ng bahay?

35. Anong oras nagbabasa si Katie?

36. Anong oras natatapos ang pulong?

37. Anong oras natutulog si Katie?

38. Anong oras sila umalis sa Camp Crame?

39. Anong pagkain ang inorder mo?

40. Anong pangalan ng lugar na ito?

41. Anong pangalan niya? Maganda siya ha.

42. Anong panghimagas ang gusto nila?

43. Anong petsa na? salubong sa akin ni Aya.

44. Anong pinag-usapan niyo ni Mommy? biglang tanong ni Maico.

45. Anong tara na?! Hindi pa tapos ang palabas.

46. Anong wala! pasinghal na sabi ni Aling Marta

47. Bakit anong nangyari nung wala kami?

48. Bigla nya akong hinigit sa kwelyo, Anong sinabi mo?

49. Dahil kung anong ganda ng katawan ay siya namang pagkaimpakto ng mukha.

50. Excuse me lang, anong mga kulay ang mayroon?

51. Excuse me, anong tawag mo sakin? nakangiting tanong ko.

52. Galit din sumagot si Amparo "Anong gusto mo alilain ako at busabusin, ako ang masusunod dahil ako ang nakakatanda".

53. Gusto kong magbasa ng libro, datapwat hindi ko alam kung anong libro ang pipiliin ko.

54. Ha? Anong konek ng gas sa taong nagugutom?

55. Hindi ko alam kung bakit ang ibang tao ay madalas na mangiyak-ngiyak sa kahit anong bagay.

56. Hindi ko alam kung bakit hindi ka pa rin nakakapag-move on sa kahit anong nangyari.

57. Hindi niya alam kung anong uri ang halamang iyon.

58. Hintayin mo ko.. Kahit anong mangyari hintayin mo ko..

59. Huh? Anong wala pa? nagtatakang tanong ko.

60. Kung anong puno, siya ang bunga.

61. Mula sa malayo, anong gulat nila Magda nang makitang nagtalunan sa ilog sina Maria at Jose upang humabol.

62. Nagpapasalamat ako sa aking mga magulang dahil sa kanilang bukas palad na pagtanggap sa akin kahit anong desisyon ko sa buhay.

63. Natigilan siya. Tila nag-iisip kung anong gagawin.

64. Pede bang itanong kung anong oras na?

65. Sa anong materyales gawa ang bag?

66. Sa anong tela gawa ang T-shirt?

67. Sa anong tela yari ang pantalon?

68. Simula noon ay hindi na nga nakikihalubilo si Paniki sa kahit anong hayop.

69. Siya ay marunong mag-gitara, bagkus walang talento sa kahit anong instrumento siya.

70. Teka anong ginagawa niyo dito? 9 na ha!

71. Teka, bakit namumula ka? Tsaka anong nangyayari sayo?!

72. Tse! Anong pakialam nyo? Bakit maibibigay ba ninyo ang naibibigay sa akin ni Don Segundo? sagot ni Aya.

Random Sentences

1. El estudiante con el peinado raro está llamando la atención de sus compañeros.

2. Tuwing mayo kung ganapin ang eleksyon.

3. Inflation kann auch durch eine Verringerung der Produktion verursacht werden.

4. Bumili si Ryan ng pantalon sa palengke.

5. Paano magluto ng adobo si Tinay?

6. Ang pagmamalabis sa pagbili ng mga hindi kailangang bagay ay maaring magdulot ng financial stress.

7. Nakita niya ata ako kaya tinigil niya yung pagsasalita niya.

8. Mas malaki ang silid-aralan ngayon kumpara sa dati dahil sa pagdami ng mga estudyante sa paaralan.

9. Ang aming kasal ay nagpapakita ng pagkakaisa at pagmamahal sa pagitan naming dalawa bilang magkabilang kabiyak.

10. Frustration can be a normal part of the learning process and can lead to personal growth and development.

11. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

12. Mas maganda kung tayo ay maging totoo sa ating sarili kaysa sa magpakatanga sa kababawan ng mundo.

13. Nagtitinda ang tindera ng prutas.

14. "A dog wags its tail with its heart."

15. Ngunit nang dahil sa iyong pagsisisi ay hindi ka pa tuluyang mawawala sa kanila.

16. Ada juga tradisi memotong tali pusar setelah kelahiran, yang dianggap sebagai tindakan penting untuk menjaga kesehatan bayi.

17. Pakukuluan ko nang apat na oras. Ikaw?

18. Ang Chinese New Year ay nagpapahayag ng pag-asa at pagbabago para sa bagong taon.

19. Eine hohe Inflation kann die Kaufkraft des Geldes drastisch reduzieren.

20. Saan naman? Sa sine o DVD na lang? tanong ko.

21. Mahilig sya magtanim ng mga halaman sa kanilang lugar.

22. Dahil sa biglaang pagkawala ng kuryente, hindi ako makapagtrabaho kanina.

23. The height of the basket and the court size varies depending on the age and skill level of the players.

24. Minsan kailangan din nating magmangiyak-ngiyak para maipakita natin ang totoong nararamdaman natin.

25. Natural language processing is a field of AI that focuses on enabling machines to understand and interpret human language.

26. Libro ko ang kulay itim na libro.

27. The laptop's hefty price tag reflected its powerful specifications and high-end features.

28. Some ailments are contagious and can spread from person to person, such as the flu or COVID-19.

29. Los motores de búsqueda nos permiten encontrar información específica en línea.

30. Hindi maiiwasang magkaroon ng mga biktima sa digmaan, kasama na ang mga sibilyan.

31. Scientific data has helped to shape policies related to public health and safety.

32. El nacimiento de un bebé es un momento de felicidad compartida con familiares y amigos.

33. Mahalaga na tuparin natin ang ating mga pangarap upang hindi natin pagsisihan sa hinaharap.

34. Ipanghampas mo ng langaw ang papel.

35. Después de haber viajado por todo el mundo, regresé a mi ciudad natal.

36. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

37. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

38. Ay shet. Ano ba yun natanong ko. Biglaan.

39. Taon-taon ako pumupunta sa Pilipinas.

40. Have they made a decision yet?

41. Hospitalization can be a stressful and challenging experience for both patients and their families.

42. Sa gitna ng kaguluhan, natagpuan niya ang kapayapaan sa pag-iisa.

43. Las hojas de las plantas de té deben secarse correctamente para obtener el mejor sabor.

44. On dit souvent que l'argent ne fait pas le bonheur, mais il y contribue grandement.

45. Mahalagang magpakatotoo sa pagpapahayag ng financial status upang maiwasan ang pagkakaroon ng maraming utang.

46. Kings may wield absolute or constitutional power depending on their country's system of government.

47. Emphasis is the act of placing greater importance or focus on something.

48. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

49. Stephen Curry revolutionized the game with his exceptional three-point shooting ability.

50. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

Similar Words

itanongtanongnagtatanongPaanongnatanongpagtatanongtinanongtinatanong

Recent Searches

anongkailanmanbagamatnakutillalamlaruanwalaintelligencedahontagalogdireksyonyumabonghinukaycanteeniiyaknagmamadalistatingbilipagsidlanestudyanteactornegroseskuwelasalitangmaghintaybilanggokasaysayanhimselfsoccerhumihingalmaasahanpansithigapamagatangkanmukhaakinporlinggo-linggosumalakayumaapawibabawmakapaniwalapinagkakaabalahanisinaramalumbaybalotisamalansanganmakatiyakglobalisasyonhamakbasketballsuspaanohubadmabigyanilongculturasinteractpopulationnaghuhumindigpadabogmagtatanimnagpanggapbinyagangpangsalapondonagsisilbiputahebahagyanayonguronatatakotnararamdamanpasukankabiyakmakinanglindolkinuskosmalamannalalamansabilangitmakakibotingkumakantananahimikeyatotoongbatokayonaksiyonnilimaslucypakiramdambanyotaosnalakininongkoronakuryentepangalanbasuratungkoltinanggapbanalcultivoatensyonhinanaplumutanghumihingigawaingkagipitanbayangmaruminataposmaninipissinghaldali-dalimag-isanglamanglalakipagraranaskailannatulalakaniladoonpoliticsmarangyangmanggadalandanpagkakamalibetamagkababataikawnaubosrinngunitdapit-haponnagingsimulamagdaraosayanregalopagluluksaikinamataypagtataposlupalopiyongcandidatesdadalhinginangbasketganidkatagapangkatpayongpag-isipanmalalimsamang-paladmakalawabitbitlikuranbabasugatanpangakomagandapagkatabing-dagatdesisyonanlungkotkahitlumisanallergydiningano-anolabananpasyapagkaingripogamotnakakulongkapagnasiradatapwatpalakanag-iisamasayang-masayasegundotamaexitdaganatatanawniyogkahariankaninumanbabasahin