Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "makapagbigay"

1. Sinuman sa kaharian ay walang makapagbigay ng lunas.

Random Sentences

1. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

2. Las serpientes son animales de sangre fría, lo que significa que dependen del ambiente para regular su temperatura corporal.

3. Ulysses S. Grant, the eighteenth president of the United States, served from 1869 to 1877 and was a leading general in the Union army during the Civil War.

4. Las personas pobres a menudo enfrentan barreras para acceder a la justicia y la igualdad de oportunidades.

5. At sa paglipas ng panahon, naging malakas na ang lalaki na nakilala nilang Damaso.

6. Motion kan udføres alene eller sammen med andre, såsom i holdtræning eller sportsaktiviteter.

7. Sa tahanan, ako'y nakatulog nang matiwasay sa aking malambot na kama.

8. La música es una forma de expresión que puede ser utilizada para conectarnos con otros y compartir nuestras emociones.

9. Christmas is a time of joy and festivity, with decorations, lights, and music creating a festive atmosphere.

10. Ang abuso sa kapangyarihan ay nagdulot ng katiwalian sa pamahalaan.

11. Market indices such as the Dow Jones Industrial Average and S&P 500 can provide insights into market trends and investor sentiment.

12. Ha?! Ano ba namang tanong yan! Wala noh!

13. Pag-akyat sa pinakatuktok ng bundok.

14. Pede bang itanong kung anong oras na?

15. Electric cars are quieter than gasoline-powered cars due to the absence of an internal combustion engine.

16. Let's just hope na magwork out itong idea ni Memo.

17. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

18. Ayaw sumindi ng ilaw. Pundido na yata.

19. Ang taong may takot sa Diyos, ay hindi natatakot sa mga tao.

20.

21. The celebration of Christmas has become a secular holiday in many cultures, with non-religious customs and traditions also associated with the holiday.

22. Sumakay pa rin sila ng bangka at umalis kasabay ng agos ng ilog.

23. Más vale prevenir que lamentar.

24. Si Hidilyn Diaz ay ang unang Pilipinong nakapag-uwi ng gintong medalya mula sa Olympics.

25. Napakalamig sa Tagaytay.

26. Mahalaga ang papel ng edukasyon sa pagpapalawig ng kaalaman at oportunidad para sa sektor ng anak-pawis.

27. Some critics argue that television has a negative impact on children, as it can lead to decreased attention spans and a lack of physical activity

28. Puwede ba kitang yakapin?

29. Sa mga sitwasyon ng buhay, ang mailap na oportunidad ay kailangan mabilis na kinukuha.

30. One of the most significant areas of technological advancement in recent years has been in the field of communications

31. "Dogs come into our lives to teach us about love and loyalty."

32. Naglipana ang mga batang naglalaro sa parke ngayong Linggo.

33. May biyahe ba sa Boracay ngayon?

34. Ofte bliver helte hyldet efter deres død.

35. Banyak orang Indonesia yang mengajarkan doa sejak usia dini, sebagai salah satu nilai-nilai agama dan moral.

36. Binigyan niya ako ng isang dosenang rosas.

37. Magbantay tayo sa bawat sulok ng ating bayan.

38. Forgiveness is not always easy, and it may require seeking support from trusted friends, family, or even professional counselors.

39. Natulak ko bigla si Maico nang may magsalita.

40. Maraming natutunan ang mga estudyante dahil sa magaling na pagtuturo ng guro.

41. Promote your book: Once your book is published, it's important to promote it to potential readers

42. Tesla has expanded its operations globally, with presence in various countries and plans for further expansion.

43. I took the day off from work to relax on my birthday.

44. Please add this. inabot nya yung isang libro.

45. Nakikita si Carlos Yulo bilang inspirasyon ng maraming kabataang Filipino.

46. Maraming misteryo ang bumabalot sa kanilang lugar.

47. Nous allons visiter le Louvre demain.

48. El nacimiento de un hijo cambia la dinámica familiar y crea un lazo fuerte entre los miembros.

49. Kapag niluluto ni Tatay ang adobo, ang amoy ay sobrang mabango at nakakagutom.

50. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Recent Searches

makapagbigaybigassumasagotlaranganedwinumangatmagsasalitaberetinakakapasokagilitylumilipadsultanatentoganyanlagimanunulatkawawangnapuyatinvolveclipdrayberiginitgitcallingpalikuranumiisodgusting-gustolikodsana-allstudynormalsumpaintutusintechnologiesbulaklaktanimanekonomiyaganitokaswapanganbagsakcondokaybilismagpa-paskopinakamatapattabihannatigilangkamisetangpunonakasuotkatipunanyelomulapasyentecultivarpalipat-lipatkitamagugustuhanlalabhanbethnasasakupanmonumentobisigexcusetitigiljustinkahirapanpeepbilerkaparehaadicionaleshahahachambersyataevensinehanmaitimpangalannagtataenakalipaschildrenjoytopic,bilibidnakahigangmalaslaruankumakapitmaritessamagraphicpublishededaddiyanproducemunangpanindaicereservesmatipunodulixviitumakboulapilanskyldes,paghugospinapakiramdamangratificante,positionerinsidentejocelynsiguradovampiresmallsfilmpadertumangodawpaskoitaaspresleymabangonag-aasikasohalalunasmaputlagumapangipinatawsilyamagaling-galinglumusoblalakingsubjectmahuhulicarbonalininaabutanpandalawahanpalayanshiphumigit-kumulangmangingibigmagtrabahodarnamagsuothabadyosabirthdaynagliwanagkatolikosaan-saannagkakatipun-tiponngayosumaliwkumanannilayuansinunggabanfatspreadlamang-lupamagandamayumingmanamis-namismisyunerohagdanmagkasing-edadbasedkakaibapinamilidaddybungapagbisitapag-unladnag-uumirieskuwelatillcrossexpertisedesarrollarforskelnatinpitakatinungolumikhapagkaingiskedyullapatpeople'soperatetawarektanggulonapakahusaymalakingtandananlalambotgradbasahinlapisumiimikisinisigawkaawa-awang