Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "kinapanayam"

1. Kinapanayam siya ng reporter.

Random Sentences

1. Maraming tao ang dumalo upang manood kung mananalo ang matanda sa batang si Amba.

2. Holy Saturday is a day of reflection and mourning, as Christians await the celebration of Christ's resurrection on Easter Sunday.

3. Musk has expressed interest in developing a brain-machine interface to help treat neurological conditions.

4. Sa pamamagitan ng malalim na paghinga at pagsasanay ng pagmameditasyon, ang aking stress ay unti-unti nang napawi.

5. Det er vigtigt at skabe en inkluderende og støttende samfund for transkønnede personer og bekæmpe diskrimination og intolerance.

6. Tanging si Tarcila lang ang walang imik ngunit malalim ang iniisip.

7. May mahalagang aral o mensahe na ipinakilala sa kabanata, naglalayong magbigay ng kahulugan at kabuluhan sa kwento.

8. He does not argue with his colleagues.

9. Ang mga dentista ay mahalagang propesyonal sa pangangalaga ng ngipin at bibig, at mahalagang sumunod sa mga payo at rekomendasyon nila upang maiwasan ang mga dental problem.

10. Det er en dejlig følelse at være forelsket. (It's a wonderful feeling to be in love.)

11. Påsken er en tid, hvor mange mennesker giver til velgørende formål og tænker på andre, der har brug for hjælp.

12. Si Carlos Yulo ay kilala bilang isa sa pinakamahuhusay na gymnast sa buong mundo.

13. A quien madruga, Dios le ayuda.

14. Wonder Woman wields a magical lasso and bracelets that can deflect bullets.

15. Buwan ngayon ng pag-aani kaya si Mang Pedro at ang iba pang mga kalakihan ay nagtungo sa bukod para anihin ang mga pananim nila.

16. Sige. Heto na ang jeepney ko.

17. Alas tres ang alis ng tren tuwing hapon.

18. Digital oscilloscopes convert the analog signal to a digital format for display and analysis.

19. Dahil sa mga kakulangan at risk na nakikita ko, hindi ako pumapayag sa kanilang plano kaya ako ay tumututol.

20. Alam ko maraming uncertainties sa buhay, pero sana pwede ba kitang mahalin?

21. Los motores de búsqueda nos permiten encontrar información específica en línea.

22. Baka nga si Amba pa gumawa ng tela aniya.

23. En algunos países, las personas solteras celebran el Día de San Valentín como el Día del Soltero.

24. Yari sa kahoy ang sahig ng bahay ko.

25. Beast... sabi ko sa paos na boses.

26. Ang paggamit ng droga ay maaaring magdulot ng pagkawala ng trabaho, pamilya, at mga kaibigan dahil sa mga problemang may kinalaman sa droga.

27. It's important to remember that April Fool's jokes should always be in good fun - nobody likes a prank that's mean or hurtful.

28. The presentation was absolutely flawless; you did a great job.

29. The pretty lady in the park was surrounded by admirers.

30. Sa pamamagitan ng kalayaan, malaya tayong magpahayag ng ating mga opinyon at paniniwala.

31. The police were trying to determine the culprit behind the burglary.

32. Ang pusa ay naglaro ng bola ng sinulid buong maghapon.

33. Maaliwalas ang langit ngayong umaga kaya masarap maglakad-lakad.

34. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

35. Alors que certaines personnes peuvent gagner de l'argent en jouant, c'est un investissement risqué et ne peut pas être considéré comme une source de revenu fiable.

36. It was invented in England by the Scottish scientist J.N. Baird in 1928 and the British Broadcasting Corporation was the first to broadcast television images in 1929. Previously the radio helped us hear things from far and near.

37. Bunso si Bereti at paborito ng ama.

38. The little girl dressed up as a pretty lady for Halloween.

39. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

40. Nasa kuwarto po siya. Sino po sila?

41. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

42. Sa pag-aaral, mas nagiging matiwasay ako kapag maayos ang aking mga talaarawan.

43. Human trafficking is a grave crime that needs immediate action worldwide.

44. La serpiente marina es una especie adaptada a la vida acuática y es una de las serpientes más venenosas del mundo.

45. Ang sinabi ng Dakilang Lumikha ay natupad.

46. Mens gambling kan være sjovt og spændende, er det også vigtigt at huske på, at det kan have negative konsekvenser, hvis det ikke håndteres på en ansvarlig måde.

47. Ang pagmamalabis sa pagkain ng matataba at malasa ay maaaring magdulot ng problema sa kalusugan.

48. Sa bawat pagkakataon na binibigyan tayo ng pagkakataon, dapat nating gamitin ito nang wasto, samakatuwid.

49. El invierno es la estación más fría del año.

50. El nacimiento de un hijo cambia la dinámica familiar y crea un lazo fuerte entre los miembros.

Recent Searches

kinapanayamkamaliannagtitindasnadumaankagandanaglulusakhistoriaisinarastreamingdeterioratenagsagawamerrybio-gas-developingmalapitanalas-dostabinginiindakaraokefilipinamoviekapasyahanmamimissmagbibiladtinawagrespektivefranciscoalagangmadalingsisipainjagiyastillnyareservesbangkopinoymaibade-latapaglalabadawaiterhagdanproductsscalegranveryzoomsukatmestduonhinilaformatthreeaplicakadaratingrobertmeanburdenpagkakatuwaanbatalansandwichberetimakakatalomakakiboartscharmingstep-by-stepmangangalakalshadeshinimas-himascancersiyudadkargahanpatawarinvedvarendemagkasakitmabatongmag-uusapmasyadongmagbabakasyonherramientasnovemberfreedomsginaorderataipipilitmatchingbukassportsposporopaglakisagottinatawagsabipangalanmamalasmaibibigaykanlurannagawangricanakakatabamaghahatidmauliniganpagkaraapagsubokrodonanglalabananangiskumampitonhismisasakinpagtangisbituinintsik-behoofrecenbolaipagmalaakitibokkalongtambayanestilosumakyatpopular1000kananlanderelativelybehalfmobilebeingmalakingenterannasquattercurrentrememberallowsamounthimayinnagsilapitairportvillagemakakabalikdiwataamuyinnaiinisnagsimulaniyogtumugtogsumasambabobokuwartonglumangabalamakapasokbeernaunagatherpaidsabertennispayatsetyembredaliritumatawadpondoninongasahancoughingcandidatesueloinlovekalakingipantalopstogabriellivesaffiliategurotupelonagpabotisasabadnageespadahanipinavedgreenestablishreducednakikilalangtinulak-tulakkinakabahannagpepekenagtuturofiguresnaglulutonanunurikadalasbibisita