Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

33 sentences found for "use"

1. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

2. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

3. Analog oscilloscopes use cathode ray tubes (CRTs) to display waveforms.

4. Cancer is caused by a combination of genetic and environmental factors, such as tobacco use, UV radiation, and exposure to carcinogens.

5. Chatbots and virtual assistants are examples of AI applications that use natural language processing to interact with users.

6. Confocal microscopes use laser technology to create 3D images of small structures.

7. Effective use of emphasis can enhance the power and impact of communication.

8. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

9. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

10. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

11. He was also a pioneer in the use of strength and conditioning techniques to improve martial arts performance

12. Jangan sampai disayang, manfaatkan waktu dengan baik. (Don't waste it, make good use of your time.)

13. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

14. Many companies use the stock market to raise capital by issuing new shares of stock to investors.

15. Many schools and universities now use television as a way to provide distance learning

16. Modern civilization is based upon the use of machines

17. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

18. Scissors can have straight blades or curved blades, depending on the intended use.

19. She does not use her phone while driving.

20. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

21. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

22. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

23. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

24. The rise of digital currencies and payment systems is changing the way people use and think about money.

25. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

26. The use of emphasis is influenced by cultural and social norms.

27. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

28. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

29. The widespread use of the telephone has had a profound impact on society

30. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

31. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

32. They are a great way to use up leftover ingredients and reduce food waste.

33. When we read books, we have to use our intelligence and imagination.

Random Sentences

1. Ang pagdadasal ng rosaryo tuwing alas-sais ng gabi ay isang ritwal na hindi nila kinalilimutan.

2. Claro que puedo acompañarte al concierto, me encantaría.

3. Kinuha nito ang isang magbubukid at agad na nilulon.

4. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

5. Captain America is a super-soldier with enhanced strength and a shield made of vibranium.

6. He has been practicing yoga for years.

7. Facebook provides tools for businesses to create and manage advertisements, track analytics, and engage with their target audience.

8. Bilhan mo ang bata ng Bumili ka ng kendi para

9. Pagkatapos ay muling naglaro ng beyblade kasama ang mga pinsan.

10. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

11. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

12. Kailangan ko munang magpahinga para mawala ang inis ko.

13. Børn har brug for tryghed, kærlighed og omsorg for at udvikle sig optimalt.

14. They have been friends since childhood.

15. Kung sino ang maagap, siya ang magandang kinabukasan.

16. Kakutis ni Kano ang iba pa niyang kapatid.

17. Bagamat naghihirap ay alaga siya ng ama't ina sa masasarap na pagkain.

18. Dahil sa alam nito na magaling siya sa kanyang kakayanang paghahabi hinamon nito ang sino man na magkipagtagisan sa kanya.

19. Coffee can be prepared in a variety of ways, including drip brewing, espresso, and French press.

20. Hindi pa nga ako nagtatanghalian eh.

21. Hindi ako sang-ayon sa mga pangyayari sa paligid natin ngayon.

22. La realidad siempre supera la ficción.

23. Tuwing may sakuna, nagkakaisa ang mga Pinoy sa pagtulong sa kapwa.

24. Kumukulo na ang aking sikmura.

25.

26. Kami ay umalis ng kaharian para ipagamot si Helena.

27. Ang pangalan ng tatay ko ay Honesto.

28. Matapos masaksihan ang kababalaghang iyon ay saka pa lang nalaman ng mga kanayon ang pagiging diwata ni Tarcila.

29. Mahalagang magkaroon ng budget plan upang maiwasan ang pagkakaroon ng utang.

30. Ang pag-aaral ng tao ay hindi lamang sa labas kundi pati sa kaibuturan ng kanyang pagkatao.

31. Stock market investing carries risks and requires careful research and analysis.

32. Many people start their day with a cup of coffee to help them wake up and feel more alert.

33. Los cuerpos de agua ofrecen un hábitat para una gran diversidad de especies acuáticas.

34. Samantala sa pamumuhay sa probinsya, natutunan niyang mas ma-appreciate ang kagandahan ng kalikasan.

35. Maraming taong sumasakay ng bus.

36. Sa bawat tula ng makata, maririnig ang malalim na hinagpis ng kanyang puso.

37. Ako po si Maico. nakangiting sabi niya.

38. Hala, change partner na. Ang bilis naman.

39. Matapos ang matagal na paghihintay, ang aking pag-aalinlangan ay napawi nang dumating ang inaasam kong pagkakataon.

40. Ayoko pong nakakulong sa madilim na lugar na kinalalagyan ko.

41. Ipinabalot ko ang pakete sa kapatid ko.

42. Hindi lahat puwede pumunta bukas.

43. Bibigyan ko ng cake si Roselle.

44. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

45. Hinugot niya ang kanyang cellphone sa loob ng kanyang bulsa upang masilip ang oras.

46. La música clásica es una forma de música que ha existido durante siglos.

47. Los powerbanks vienen en diferentes capacidades, que determinan cuántas cargas pueden proporcionar.

48. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

49. Bukas ay pumunta daw po kayo sa school sabi ng aking teacher.

50. Sino ang kasama ng ate mong naglakad kahapon?

Similar Words

MassachusettsExcusehouseusedcauseshouseholdsmisusedJailhousehousehold

Recent Searches

halagausenagwo-workbumigayisapaanongdumimag-aralmasayang-masayangsiponsinundomagsalitaarguesinampalmusmostinungonagta-trabahosinateleponomagworkmahirapvedamountdeterminasyonnagpaalamsusimanypag-uugalipisngisumasagotbatalanopportunityhiramtumubopinunitvidenskabnapalakasnapapadaanpinabayaangamotmabangoitukodshetmahinahongunattendedbateryalinggofacemaskbangmangahaspalakabasapookdogpagtatanimbecamegatolmagtanimmagturolintawaitkapintasanggumawanagtatanimpalayokhetodigitalmulingbutterflybinigyangpapayagmaghapongmarchmapapansinumagangadvancementcapacidadesmedicineparusahanlandasmagdaraosmakamitguerreronatutoparehaspinalitanbukanewmaghahandamatakotpagbabayaditinaliluisaspecializedusingnakipagrealrevolucionadotipidnamanghanagkakilalafarmpaghahabidumalolihimgalawhindemaulitracialnangumbidaabutanstreetkatulongnitodumukotsino-sinomaghihintaydisappointedkilalang-kilalamatamiscutkwebahumanoanacarebangkongfollowingeksenayunmasokspeedphilosophydistanciakansernangalaglagtumagalfanspanghihiyangparkealagakaarawanfarpaki-ulitpanalangininilistapagluluksapulakaparusahankitaboksingsilaynangapatdanenchantedkadalasmasyadongdiyabetisfriendnawalangpatingrightconnectionculprithinandenmamayangnagpapaypaytumatawadnakabanggapanghabambuhaypakikipaglabaneducationaleskwelahanloobituturomalakinalugmokfauxmagtakasystems-diesel-runtravelerkakaibangandrewprocesolawaymaidmasyadotiradorngayonboxingpopulationpaga-alalamaskaragumalahimutokpinangkarangalancontestmakatawalumbaytenerstep-by-step