Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

33 sentences found for "use"

1. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

2. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

3. Analog oscilloscopes use cathode ray tubes (CRTs) to display waveforms.

4. Cancer is caused by a combination of genetic and environmental factors, such as tobacco use, UV radiation, and exposure to carcinogens.

5. Chatbots and virtual assistants are examples of AI applications that use natural language processing to interact with users.

6. Confocal microscopes use laser technology to create 3D images of small structures.

7. Effective use of emphasis can enhance the power and impact of communication.

8. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

9. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

10. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

11. He was also a pioneer in the use of strength and conditioning techniques to improve martial arts performance

12. Jangan sampai disayang, manfaatkan waktu dengan baik. (Don't waste it, make good use of your time.)

13. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

14. Many companies use the stock market to raise capital by issuing new shares of stock to investors.

15. Many schools and universities now use television as a way to provide distance learning

16. Modern civilization is based upon the use of machines

17. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

18. Scissors can have straight blades or curved blades, depending on the intended use.

19. She does not use her phone while driving.

20. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

21. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

22. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

23. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

24. The rise of digital currencies and payment systems is changing the way people use and think about money.

25. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

26. The use of emphasis is influenced by cultural and social norms.

27. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

28. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

29. The widespread use of the telephone has had a profound impact on society

30. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

31. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

32. They are a great way to use up leftover ingredients and reduce food waste.

33. When we read books, we have to use our intelligence and imagination.

Random Sentences

1. Wenn die Inflation zu schnell ansteigt, kann dies zu einer Wirtschaftskrise führen.

2. Ayaw niya ng mga maarteng bagay kaya hindi siya mahilig sa mga mamahaling gamit.

3. The blockchain technology underlying cryptocurrency allows for secure and transparent transactions.

4. Ang umuulan nang malakas ay binulabog ang mga kalsada at nagdulot ng matinding baha.

5. Nagbigay ng biglaang meeting ang boss ko kanina kaya hindi ako nakapaghanda.

6. Ang kagutuman ay laganap sa mga lugar na may kalamidad.

7. Malinis ang kuwarto ng mga magulang ko.

8. Tinuruan niya ang kanyang anak na maging magalang sa mga nakatatanda.

9. Napasigaw ang naghihinagpis na ina! Hindi nito maatim ang nakikitang paghihingalo ng mga anak.

10. Ginamot sya ng albularyo.

11. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

12. Let's stop ignoring the elephant in the room and have an honest conversation about our problems.

13. Iniintay ka ata nila.

14. Dapat kong bilhan ng regalo si Maria.

15. Before a performance, actors often say "break a leg" to each other for good luck.

16. Wait lang ha kunin ko lang yung drinks. aniya.

17. Limitations can be physical disabilities, such as hearing or vision loss, or mental health conditions, such as anxiety or depression.

18. La tos aguda dura menos de tres semanas y generalmente se debe a una infección viral.

19. Marami siyang ginawang pagkakamali sa proyekto, samakatuwid, hindi ito natapos sa takdang oras.

20. Naglipana ang mga ibon sa hardin ngayong tag-araw.

21. Baka puwedeng hiramin mo ang iyong sasakyan para sa isang biyahe.

22. Nag-ugat sa puso ni Durian na mahalin ang sakop ng kanyang ama.

23. Sinakop ng mga espanyol ang Pilipinas nang mahigit sa 300 years.

24. Sa ganang iyo, mahalaga ba talaga ang pagkakaroon ng mataas na grado sa eskwelahan?

25. Sa kabila ng lahat ng pagsubok na dumadating sa atin, ang mga kanta ng Bukas Palad ay patuloy na nagbibigay ng pag-asa at liwanag.

26. The doctor prescribed antibiotics to treat the pneumonia.

27. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

28. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

29. Higupin ng basang tuwalya ang tubig sa mesa.

30. Bawat galaw mo tinitignan nila.

31. Sa mga tabing-dagat, naglipana ang mga maliliit na kabahayan.

32. Nagbabaga ang araw sa gitna ng tanghali, dahilan upang mabilis na matuyo ang mga damit.

33. La armonía entre los instrumentos en la música de Beethoven es sublime.

34. Nahuli ang magnanakaw ng mga sibilyan at iniharap ito sa mga pulis.

35. Ang kasal ay isa sa pinakamahalagang okasyon sa buhay ng isang tao.

36. Pupunta kami sa Laguna sa makalawa.

37. Di Indonesia, bayi yang baru lahir biasanya diberi nama dengan penuh makna dan arti.

38. Saan pa kundi sa aking pitaka.

39. The sound of the waves crashing against the shore put me in a state of euphoria.

40. Børn har brug for at lære om kulturelle forskelle og respekt for mangfoldighed.

41. Sa mga nakalipas na taon, yumabong ang mga blog na mayroong malaking audience.

42. Bilang paglilinaw, ang proyekto ay hindi kanselado kundi ipinagpaliban lamang.

43. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

44.

45. Maaga dumating ang flight namin.

46. I have a Beautiful British knight in shining skirt.

47. Hindi pa rin makapagsalita si Mang Kandoy.

48. La realidad es que necesitamos trabajar juntos para resolver el problema.

49. Dumaan ako sa silid-aralan upang magpasa ng papel sa guro.

50. Pinayuhan siya ng doktor tungkol sa pangangalaga sa bungang-araw.

Similar Words

MassachusettsExcusehouseusedcauseshouseholdsmisusedJailhousehousehold

Recent Searches

usepagdiriwangunanexplainwownasasalinansisentanasasakupanpaghalakhakmantikanasasabihankumustanapatingalakasaganaannapapatungobroadnapakatagalnapakalusogedukasyonnapakalamignapakalakasnapakahusaykakauntogimpornapakagandapang-aasarmagsi-skiingnapakabangonapaghatiannaninirahanadaproducirnutrientsasinnangingisaynanghahapdinangangaralnangangaloghydellordipinadalanangangalitnangangahoynangampanyanananaginipnananaghilinalulungkotnakikihukaynakatuwaangmagkasintahanmalaki-lakinakatitiyaknakatingingvaccinesnakatindigsinusuklalyannakapaligidnakapagusaplumisannakalilipaskakayanangnakakapuntanagtatanongkausapinnakapagsabituktokkemi,pisonakangitinglungkutpinansinmediantekotsesigurolandasmakikipaglarongisikatapatmalambotpilipinonahihilowasakkindskapainnagiginguponconstantlyimprovenerissapotentialipagmalaakiinastapaggawayamanbawatmabutivideos,malapittaga-suportabeginningspeksmanmabatongmasyadongpaglalabakaklasenamansagotpunobevarejacesundhedspleje,kategori,pagtatanimkeeppatimagpakasalaalisnilinisboksingpinyasinipangeskwelahanpaglalayagnaglipanangmagkakaanaknakakadalawnapadpadmaipapautangmagulayawmagtiwalaminamahalnagkwentobumisitanakakagalanaglalaromamanhikanreceptorkampeonbumaligtadpicturesibinaonkagubatannapakaunoskusinapagsidlaniikotpinagpapaalalahananpagsusulitpulubigagamitchristmastelecomunicacionesnatanongparangtres1929areasumaagosbutchsoreakmangofrecentinikpromoteexpeditedstreetnapatinginmayamaninimbitakasakitibinentadalawangpayongspecializedduridayscafeteriaguestsinformedipinalutohighestpackaginginteligentesbalitahigpitanmakesmalakingdingdingfacilitatingvistilgangnagtatrabahosagingtandathroughoutlulusogdamitpedesteer