Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

33 sentences found for "use"

1. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

2. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

3. Analog oscilloscopes use cathode ray tubes (CRTs) to display waveforms.

4. Cancer is caused by a combination of genetic and environmental factors, such as tobacco use, UV radiation, and exposure to carcinogens.

5. Chatbots and virtual assistants are examples of AI applications that use natural language processing to interact with users.

6. Confocal microscopes use laser technology to create 3D images of small structures.

7. Effective use of emphasis can enhance the power and impact of communication.

8. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

9. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

10. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

11. He was also a pioneer in the use of strength and conditioning techniques to improve martial arts performance

12. Jangan sampai disayang, manfaatkan waktu dengan baik. (Don't waste it, make good use of your time.)

13. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

14. Many companies use the stock market to raise capital by issuing new shares of stock to investors.

15. Many schools and universities now use television as a way to provide distance learning

16. Modern civilization is based upon the use of machines

17. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

18. Scissors can have straight blades or curved blades, depending on the intended use.

19. She does not use her phone while driving.

20. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

21. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

22. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

23. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

24. The rise of digital currencies and payment systems is changing the way people use and think about money.

25. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

26. The use of emphasis is influenced by cultural and social norms.

27. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

28. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

29. The widespread use of the telephone has had a profound impact on society

30. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

31. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

32. They are a great way to use up leftover ingredients and reduce food waste.

33. When we read books, we have to use our intelligence and imagination.

Random Sentences

1. Lights the traveler in the dark.

2. Nagtapos siya sa kolehiyo noong 1990.

3. Algunas obras de arte son consideradas obras maestras y son muy valoradas.

4. Lumaki si Ranay na ang trabaho ay kumain at ang libangan ay kumain parin.

5. Después de hacer la compra en el supermercado, fui a casa.

6. Isa sa tatlong magagandang magkakapatid si Psyche.

7. Sa pagguhit, mahalaga ang pagpapakita ng depth at perspective sa mga larawan para maging realistic ang mga ito.

8. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

9. Iron Man wears a suit of armor equipped with advanced technology and weaponry.

10. Punta tayo sa park.

11. Hindi matanggap na malisan sa kanyang iniibig ay mahigpit nyang hinawakan ang kamay ng prinsipe.

12. Nakapagsasakay ang dyipni ng 16 na pasahero.

13. Nandito ang mga kaklase ni Raymond.

14. Sa kaibuturan ng kanyang damdamin, mahal niya ang kanyang mga kaibigan.

15. Lebih baik mencegah daripada mengobati.

16. Siya ay apatnapu't limang taong gulang at nakapangasawa sa isa sa mga magaling tumugtog ng piyano

17. Oh Aya, napatawag ka? mejo bagsak ang boses ko.

18. Anong klaseng karne ang ginamit mo?

19. Omelettes can be made using egg whites only for a healthier, lower-fat option.

20. As your bright and tiny spark

21. Nagpahayag ng reklamo ang mga estudyante dahil sa sobrang lamig sa silid-aralan.

22. Paglingon niya, nakakita siya sa kanyang tabihan ng isang munting palaka na parang nakatinging sa kanya

23. We admire the courage of our soldiers who serve our country.

24. Magsi-skiing ako sa buwan ng Enero.

25. Nood tayong movie. maya-maya eh sabi niya.

26. Let's keep things in perspective - this is just a storm in a teacup.

27. Ano ang kulay ng mga prutas?

28. Drømme kan inspirere os til at være vores bedste selv og opnå vores fulde potentiale.

29. I absolutely agree with your point of view.

30. May masakit ba sayo?? Ok ka lang ba?

31. Ang mga mamamahayag ay nagsusulat ng mga balita para sa pampublikong impormasyon.

32. Ginagamit ang salitang "waring" upang ipahiwatig ang isang hinuha o tila isang bagay na maaaring totoo, ngunit hindi pa tiyak.

33. Sumulat ng tula ang aking guro sa aming klase at pinabasa sa amin.

34. Kahit saang parte ng mundo ay may makikita ka pa ring gumagamit ng illegal na droga.

35. La habilidad de Da Vinci para dibujar con gran detalle y realismo es impresionante.

36. Sa ganang iyo, dapat bang manatili sa kanilang posisyon ang mga opisyal na hindi epektibo?

37. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

38. Ang bituin ay napakaningning.

39. Natawa kami sa inasta ni Sara dahil para siyang bata.

40. Los océanos contienen la mayor cantidad de agua en la Tierra.

41. Sa mga huling taon, yumabong ang turismo sa lugar na ito dahil sa mga magagandang tanawin.

42. AI algorithms can be used in a wide range of applications, from self-driving cars to virtual assistants.

43. Sama ako. inulit nya lang ang sinabi nya.

44. Mula sa tuktok ng bundok, natatanaw ko ang magandang tanawin ng kapatagan.

45. Ayaw mo ba? tanong niya sa malungkot na tono.

46. Ang kagandahan ng sunset sa beach ay animo'y pagpapahinga para sa kaluluwa.

47. Some people like to add a splash of milk or cream to the beaten eggs for a creamier texture.

48. I am not exercising at the gym today.

49. Don't spill the beans about the project, it's supposed to be a secret.

50. Paulit-ulit na niyang naririnig.

Similar Words

MassachusettsExcusehouseusedcauseshouseholdsmisusedJailhousehousehold

Recent Searches

useplantashacertataydesisyonankonsentrasyonwalangmagtipidmagpagupitairportmahalagarevisenaglalakadpanahonfindsapatfrescoinstrumentaldapit-haponsoportepracticeskasoyjingjingmatesagovernmentbutipakukuluandumaraminoodlendkaarawankrusbastapropesoralignsmagbalikmayothreemediayatawaritindahannakikitakabutihanbabamaisipmalagovictoriajeepneywondersmasayang-masayangsilawishingjapansirasalesipatuloymagsi-skiingbansangayusinamazonbalakbakakamiaspagiisipharapanvedkalupimabangosinabinagdarasalleadpinapalogusting-gustokamaopaga-alalakailangangkirotbarangaypootnungiyofulfillingnagpaalamlangkaylalim4thsimplengyundumikitpaghakbangmanghikayatwalang-tiyaksananapakabutimaintainleadersparketopicvitalgreatlynag-asarannakatalungkoworrykastilarebolusyonano-anoblusablessnyaimprovementmisteryokoronaprogresspansitmasoktarangkahan,itsnakasakitmasayahinritadoble-karanamumulottools,magtatagalkurbatacontinuesattorneyumupopaglakipusangdoingsunculturesmagkasamangnilimasquicklyipapaputolnagpapanggapklasengnumerosaspapayacasaleukemiamasasalubongadvancesmarmaingdeclarepamamalakadboynapanoodeffectpinilingfundrisemagdaanpaksapinggaoffernazarenokutoencuestashinding-hindirecordedprosesolungsodpaskonanlilimahidxviikatawanamingtuluy-tuloymagtanghalianmayroonnanakawanhinahangaanpositionertwopunong-punobakurangawainggapnakakapagodkasiyahangdiplomaparisukattumahanrisethenkendtkakilalanakayukostartmaglalaronewkungboholmadalastonyoadvancetraje