Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

33 sentences found for "use"

1. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

2. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

3. Analog oscilloscopes use cathode ray tubes (CRTs) to display waveforms.

4. Cancer is caused by a combination of genetic and environmental factors, such as tobacco use, UV radiation, and exposure to carcinogens.

5. Chatbots and virtual assistants are examples of AI applications that use natural language processing to interact with users.

6. Confocal microscopes use laser technology to create 3D images of small structures.

7. Effective use of emphasis can enhance the power and impact of communication.

8. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

9. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

10. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

11. He was also a pioneer in the use of strength and conditioning techniques to improve martial arts performance

12. Jangan sampai disayang, manfaatkan waktu dengan baik. (Don't waste it, make good use of your time.)

13. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

14. Many companies use the stock market to raise capital by issuing new shares of stock to investors.

15. Many schools and universities now use television as a way to provide distance learning

16. Modern civilization is based upon the use of machines

17. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

18. Scissors can have straight blades or curved blades, depending on the intended use.

19. She does not use her phone while driving.

20. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

21. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

22. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

23. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

24. The rise of digital currencies and payment systems is changing the way people use and think about money.

25. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

26. The use of emphasis is influenced by cultural and social norms.

27. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

28. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

29. The widespread use of the telephone has had a profound impact on society

30. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

31. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

32. They are a great way to use up leftover ingredients and reduce food waste.

33. When we read books, we have to use our intelligence and imagination.

Random Sentences

1. They have been creating art together for hours.

2. Sayang, jangan khawatir, aku selalu di sini untukmu. (Don't worry, dear, I'm always here for you.)

3. Nilagdaan niya ang kasunduan sa Biak-na-Bato noong 1897 para sa pansamantalang kapayapaan.

4. The character in the movie was content in his simple life, believing that ignorance is bliss.

5. He was busy with work and therefore couldn't join us for dinner.

6. Nahawakan ko ang katawan ko, Umabot ba kami hanggang dun?

7. Tinangka umano ng pulis na kausapin ang mga nagpoprotesta bago sila buwagin.

8. Una mala conciencia puede llevarnos a tomar malas decisiones.

9. Sa anong tela yari ang pantalon?

10. Sa likod ng mga tala, kahit sulyap lang, Darna

11. The United States is a culturally diverse country, with a mix of ethnicities, languages, and religions.

12. We have been cooking dinner together for an hour.

13. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

14. "You can't teach an old dog new tricks."

15. Ginagamit ang "tila" upang ipakita ang pagkakahawig o pagsasalarawan ng isang bagay, sitwasyon, o damdamin na hindi ganap na tiyak ngunit may pagkakahawig sa isang bagay o pangyayari.

16. Maaaring magbigay ng libro ang guro sa akin.

17. Mahalagang igalang ang kalayaan ng ibang tao sa pagpapasiya ng kanilang mga sariling buhay.

18. Dahil sa aksidente sa pagpapatakbo ng negosyo, nagsara ang kumpanya at maraming tao ang nawalan ng trabaho.

19. Dahil sa pagiging maramot, madalang siyang bisitahin ng kanyang mga kaibigan.

20. The hotel room had an absolutely stunning view of the city skyline.

21. Up above the world so high

22. Nous avons réservé une salle de réception pour la célébration.

23. Nasa harap ng tindahan ng prutas

24. Ang resiliency ng mga Pinoy ay patunay ng kanilang lakas sa harap ng pagsubok.

25. Labis na ikinatuwa ng mag-asawa ang biyayang ito,pangalanan nila ang bata na Rabona, pinaghalo ang pangalan ni Rodona at ang bundok ng Rabba.

26. Wala yun. Di ko nga naisip na makakatulong. aniya.

27.

28. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

29. From: Beast Nasaan ka? Bakit di mo ako hinintay?

30. Puwede magdala ng radyo ang kaibigan ko.

31. Lumakad ako nang mag-isa sa madilim na daan at nagitla ako nang biglang may humawak sa aking balikat.

32. Magandang araw, sana pwede ba kita makilala?

33. Wonder Woman wields a magical lasso and bracelets that can deflect bullets.

34. Maarte siya sa mga lugar na pupuntahan kaya hindi siya nakikipagsiksikan sa mga madaming tao.

35. Pinalitan nya ng diaper ang umiiyak na sanggol.

36. Minsan ay isang diwata ang nagpanggap na isang babaeng madungis.

37. Tapos humarap sya sakin, Eh bakit ba nila ginawa yun?

38. Si Hidilyn Diaz ay naging inspirasyon din sa iba’t ibang mga atleta sa buong mundo.

39. Nagulat ako nang biglaan siyang tumawag at nangumusta sa akin.

40. Saan niya pinapagulong ang kamias?

41. Punta tayo sa park.

42. Sa kaibuturan ng kanyang pagkatao, mahal niya ang pamilya niya.

43. Limitations can be challenging, but they can also inspire creativity and innovation.

44. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

45. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

46. Hindi maganda ang epekto ng laging pagmamangiyak-ngiyak dahil nakakasira ito ng morale at nakakapagpababa ng confidence.

47. En invierno, la ropa de invierno, como los abrigos y las botas, está en alta demanda.

48. Matagal na kitang pinapanood at ngayon lang ako maglalabas ng katotohanan - may gusto ako sa iyo.

49. Duon nakatira ang isang matandang babae at ang kanyang apo, isang binatilyo.

50. Sa pagdiriwang ng fiesta, ang bayanihan ay nagiging mas makikita sa paghahanda at pagdaraos ng mga aktibidad.

Similar Words

MassachusettsExcusehouseusedcauseshouseholdsmisusedJailhousehousehold

Recent Searches

usekundimanpinakidaladesisyonanpagmamaneholordnaglipanangrealisticnariningnetflixheartbreakaminkoreagabingradyogalaksaanmidtermsariwatuluy-tuloynag-replypatuloyhinipan-hipanayudananagkanyatibigiyobecomedamdaminluzlagaslasskills,dulochildrenmagtipidnatatawangtingnakatiradahilinihandaginoongpagtatanghalkitanapapadaangrewelectionstinigconnagmamadalihinahaplosbodegapakibigay1982danzapeepgumawanagpalutobinatangayonbakapaghahanguanhulyoibat-ibanglacksusunodinagawspeechtalentpaligsahansulyapnapasobratokyonagitlabagyongcompletingsumuwayknowledgenagtuloyknowdividessequeenergy-coalmonumentosariling300consideredpaidimportantenatalongkatagangyoumangemayamayaimpactsilangsayanochekeepingpagkakalutorosellemanilakahusayanclocklegislationpinapakingganpulubiniyashortgawinmag-uusapmatchingpananakopdrawingtamaantumambaditinaponmasipongbulsatogetherkahuluganlumusobmataaasmagworkpresleyomeletteanihospitalmakukulaypupuntayesenchantedipantalopaaisshnangingitianpanitikannagbantaypasasalamatgawingwakasideasundeniableellen1787masamangkinalalagyankanserlendmalalimsoccernagcurvemasinopsanggolkuwartoatinkararatingpagodsakimsparklamangubopagnangangalogunohardinbusyangaksiyonpocatumugtoglugawjacky---nanaykuripotbilangrenevalleysinumanmarahilanyoayansumusunodkongnanaisinkulangmaaringseamasayanakasalubonghanhumahangosconsuelokasalukuyannagtuturoprosperplantasmediumpetermodernebar