Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

33 sentences found for "use"

1. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

2. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

3. Analog oscilloscopes use cathode ray tubes (CRTs) to display waveforms.

4. Cancer is caused by a combination of genetic and environmental factors, such as tobacco use, UV radiation, and exposure to carcinogens.

5. Chatbots and virtual assistants are examples of AI applications that use natural language processing to interact with users.

6. Confocal microscopes use laser technology to create 3D images of small structures.

7. Effective use of emphasis can enhance the power and impact of communication.

8. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

9. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

10. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

11. He was also a pioneer in the use of strength and conditioning techniques to improve martial arts performance

12. Jangan sampai disayang, manfaatkan waktu dengan baik. (Don't waste it, make good use of your time.)

13. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

14. Many companies use the stock market to raise capital by issuing new shares of stock to investors.

15. Many schools and universities now use television as a way to provide distance learning

16. Modern civilization is based upon the use of machines

17. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

18. Scissors can have straight blades or curved blades, depending on the intended use.

19. She does not use her phone while driving.

20. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

21. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

22. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

23. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

24. The rise of digital currencies and payment systems is changing the way people use and think about money.

25. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

26. The use of emphasis is influenced by cultural and social norms.

27. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

28. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

29. The widespread use of the telephone has had a profound impact on society

30. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

31. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

32. They are a great way to use up leftover ingredients and reduce food waste.

33. When we read books, we have to use our intelligence and imagination.

Random Sentences

1. Higupin ng araw ang tubig-ulan sa kalsada.

2. Ang mumura ng bilihin sa divisoria.

3. Pakibigay ng malinaw na paliwanag sa tanong upang mas madali itong maunawaan.

4. Det er vigtigt at huske heltenes bedrifter og lære af dem.

5. The company's losses were due to the actions of a culprit who had been stealing supplies.

6. Mathematics is an essential tool for understanding and shaping the world around us.

7. Nagtatrabaho ako tuwing Martes.

8. Sa pagpupulong ng mga pulitiko, inilahad nila ang kanilang mga mungkahi upang maisulong ang mga batas at polisiya.

9. The damage done to the environment by human activity is immeasurable.

10. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

11. Hospitalization can be a stressful and challenging experience for both patients and their families.

12. Sa kanyang huling araw sa opisina, nag-iwan siya ng liham ng pasasalamat sa kanyang mga kasamahan.

13. En invierno, muchas personas disfrutan de deportes como el esquí y el snowboard.

14. Entschuldigung. - Excuse me.

15. Ilang taon ka tumira sa Saudi Arabia?

16. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

17. Chris Paul is a skilled playmaker and has consistently been one of the best point guards in the league.

18. Durante las vacaciones de Semana Santa, asistimos a procesiones religiosas.

19. Ang kalayaan ay hindi dapat magdulot ng pang-aabuso sa kapwa.

20. Nagsmile siya, Uuwi ka ha.. uuwi ka sa akin..

21. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

22. Ang pangamba ay kadalasang sanhi ng hindi pagpapakatotoo sa ating mga nararamdaman at saloobin.

23. Naghanda kami ng sorpresa para sa kanya.

24. Dahil sa pagtatapos ng isang mahabang relasyon, siya ay puno ng lungkot at panghihinayang.

25. Nag-aaral tayo ng Tagalog ngayon.

26. Si tienes paciencia, las cosas buenas llegarán.

27. Sa lipunan, ang pagiging marangal at matapat ay dapat na itinuturing at pinahahalagahan.

28. Captain Marvel possesses cosmic powers and is one of the most powerful superheroes in the Marvel Universe.

29. Maghintay ka nang kaunti, sagot ng lola habang abalang nagta-trabaho.

30. They launched the project despite knowing how risky it was due to time constraints.

31. Pumasok ako sa cubicle. Gusto ko muna magisip.

32. Nais sanang magbago ng isip si Magda, ngunit nanaig ang kanyang pagkagusto kay Damaso.

33. The cost of a wedding can vary greatly depending on the location and type of wedding.

34. Håbet om at opnå noget kan give os styrke og energi.

35. Her lightweight suitcase allowed her to pack everything she needed for the weekend getaway without exceeding the airline's weight limit.

36. Ang linaw ng tubig sa dagat.

37. Hinabol kami ng aso kanina.

38. Bumili ako ng sarong. Ikaw, saan ka nagpunta?

39. El cordón umbilical, que conecta al bebé con la placenta, será cortado después del nacimiento.

40. The app has also been praised for giving a platform to underrepresented voices and marginalized communities.

41. The most famous professional basketball league is the NBA (National Basketball Association), which is based in the United States.

42. Naglaba ang kalalakihan.

43. Nakarinig siya ng tawanan.

44. The first mobile phone was developed in 1983, and since then, the technology has continued to improve

45. Mahalaga na hindi tayo mawalan ng pag-asa sa ating mga pangarap.

46. Sa Sabado, alas-diyes ng umaga.

47. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

48. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

49. Naging mayaman din ang mag-anak dahil sa mga bentang tela na ginagawa ng bata.

50. Naniniwala ang ilang tao na ang albularyo ay may kakayahang mag-alis ng masamang espiritu.

Similar Words

MassachusettsExcusehouseusedcauseshouseholdsmisusedJailhousehousehold

Recent Searches

usegappageantautomaticgovernmentnakasahodnegosyooverviewinabotpanonoodmainitlucasnandyanhalakhakdeletamangkananpitakananaisinnagmamaktolcubapansamantalabinigyanglugarlumahokbandamasarappootearlypansitmasayang-masayaneed,angkan1960saplicacionespiyanokapeteryabillbasahinganoonitutuksolumakadcommunitypagkaangatbugtongbumalingbetaninumanpriestsinuotmaalogberegningernapuputoldiyosatagumpaybusloumabotcompartenpumapaligidpooksigloresignationcanuulamingandahanfrarewardingpopulationwideilangpwedengika-12effektivnoelgainpasigawbiglaanblusagumuhitdumilimpioneermaongranaynaturgradsigurobumibitiwhalipmonumentophysicalspongebobnapatinginhatemaalikabokmahiraptumingincomputerewasteapelyidobulawikamagpakasalninahapunanmaaliwalastinitirhansinumanapatnapusumasayawanongventanagpasamasinepataypalakoldrenadomanirahanniyakapjagiyasharekalongsomekonsultasyonfatstruggledknightpalaisipandatapwatliigpupuntapare-parehonagsisunodfreelancing:bighanidulahumarappalayonanginginigkahithitahistorialabananmaagapankumalmai-googlehanginmerchandisereachingparusahantiniradorlingidnakatitiggutommalakiandrewsubalitmelvinmanoodamazongulayadangalesmommypang-isahangnagdudumalingparemaprosarioyorkimprovetissueabalangmassesnananalonewtaongmasterpalagingroofstocklasingpopularsimbahantinangkasiguradonilimasmatipunokanginafarmmisspagtinginaraw-transmitsisladinsumimangotnamissipapautangcaketeachsus