Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

33 sentences found for "use"

1. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

2. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

3. Analog oscilloscopes use cathode ray tubes (CRTs) to display waveforms.

4. Cancer is caused by a combination of genetic and environmental factors, such as tobacco use, UV radiation, and exposure to carcinogens.

5. Chatbots and virtual assistants are examples of AI applications that use natural language processing to interact with users.

6. Confocal microscopes use laser technology to create 3D images of small structures.

7. Effective use of emphasis can enhance the power and impact of communication.

8. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

9. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

10. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

11. He was also a pioneer in the use of strength and conditioning techniques to improve martial arts performance

12. Jangan sampai disayang, manfaatkan waktu dengan baik. (Don't waste it, make good use of your time.)

13. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

14. Many companies use the stock market to raise capital by issuing new shares of stock to investors.

15. Many schools and universities now use television as a way to provide distance learning

16. Modern civilization is based upon the use of machines

17. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

18. Scissors can have straight blades or curved blades, depending on the intended use.

19. She does not use her phone while driving.

20. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

21. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

22. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

23. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

24. The rise of digital currencies and payment systems is changing the way people use and think about money.

25. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

26. The use of emphasis is influenced by cultural and social norms.

27. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

28. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

29. The widespread use of the telephone has had a profound impact on society

30. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

31. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

32. They are a great way to use up leftover ingredients and reduce food waste.

33. When we read books, we have to use our intelligence and imagination.

Random Sentences

1. Kapag bukas palad ka sa mga taong hindi mo pa nakikilala, mas maraming taong pwedeng maging kaibigan mo.

2. Nationalism can have a positive impact on social and economic development.

3. Dancing all night at the club left me feeling euphoric and full of energy.

4. Ang mga pamilya ay nag-aayos ng mga handa at nagdadasal para sa kasaganaan sa darating na taon.

5. S-sorry. nasabi ko maya-maya.

6. Mahalaga ang maagap na pagtugon sa pangamba upang maiwasan ang mas malaking panganib.

7. Ang talento ng mga Pinoy sa pagkanta ay hinahangaan sa buong mundo.

8. Sa mga nakalipas na taon, yumabong ang mga organisasyon na tumutulong sa mga nangangailangan.

9. Elektronikken i en bil kan hjælpe med at forbedre kørsel og sikkerhed.

10. Masaya ang buhay kapag mayroong kaulayaw na handang tumulong sa iyo.

11. May bagong aklat na inilathala ukol kay Manuel Quezon at tungkol ito sa pag-unlad ng teknolohiya.

12. Mi amigo es un excelente cocinero y siempre me invita a cenar en su casa.

13. Kalaunan, pati ang tanim ng may tanim ay lihim nitong sinisira.

14. Ibinigay ni Aling Marta ang kanyang pangalan at tinitirhan at pagkatapos ay tuwid ang tinging lumayo sa karamihan.

15. Kailangan nating magbago ng mga lumang gawi, datapapwat ay mahirap ito gawin dahil sa kawalan ng disiplina ng iba.

16. Ayoko magtrabaho sa bahay sapagkat naiinis ako sa buhok na ito.

17. Comer una dieta equilibrada puede aumentar los niveles de energía y mejorar el estado de ánimo.

18.

19. Lumapit siya sa akin tapos nag smile. Nag bow ako sa kanya.

20. Napapikit ako at naglabas ng malalim na himutok upang maibsan ang aking pagod.

21.

22. Les personnes âgées peuvent faire face à la fin de leur vie avec courage et dignité.

23. Don't put all your eggs in one basket

24. Magkita tayo bukas, ha? Please..

25. Ang marahas na pag-atake ay labag sa batas at maaaring magdulot ng malubhang parusa.

26. Inirekomenda ng guro na magbasa kami ng maraming aklat upang mapaunlad ang aming kasanayan sa pagbabasa.

27. During hospitalization, patients receive medical care from doctors, nurses, and other healthcare professionals.

28. Hindi na nakarating ang mensahe ni Andy sa kanyang ina.

29. Honesty is the best policy.

30. I sent my friend a bouquet of flowers and a card that said "happy birthday."

31. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

32. Para sa kaibigan niyang si Angela

33. Las plantas suculentas son conocidas por su capacidad para almacenar agua en sus tejidos.

34. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

35. I hate it when people beat around the bush instead of just getting to the point.

36. Les hôpitaux sont des lieux où les patients peuvent recevoir des soins spécialisés.

37. Eksport af grøn energi er en vigtig del af den danske eksportstrategi.

38. Limitations can be physical disabilities, such as hearing or vision loss, or mental health conditions, such as anxiety or depression.

39. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

40. Limitations can be perceived or real, and they can vary from person to person.

41. Pumunta kami sa may bar ng bahay nila.

42. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

43. Napakamot na lang ng ulo si Kenji.

44. Gusto pa niyang magbalik sa sulok na kanyang higaan.

45. Kung mababatid lang ng mga tagaroon ang katotohanan, marahil hindi na sila magtataka kung bakit namumukod-tangi ang kagandahan nina Lala, Dada at Sasa.

46. Tinanggap niya ang lahat ng ito at marami pang iba sa kaniyang kaarawan.

47. Mi sueño es convertirme en un músico famoso. (My dream is to become a famous musician.)

48. Hindi niya naiilagan ang dagok ni Ogor.

49. El estudio científico produjo resultados importantes para la medicina.

50. Den danske kirke fejrer påsken med flere forskellige ceremonier i løbet af Holy Week.

Similar Words

MassachusettsExcusehouseusedcauseshouseholdsmisusedJailhousehousehold

Recent Searches

usepalibhasaprintpagkakatayohiramgreatermatandang-matandaroonenfermedades,taongayunmaninarumaragasangsumigawkinatatalungkuanghappierpiratahinagpisamingipinagbibiligasolinamakakibocnicohalalanmuranggustoblogmaliitmabangopeksmannangahaseskwelahanmababawinhaleorugateachipaalamimportantpreskolalimflavioconvertingmagagamitbagalgraduallybotongfathersinumanmuntingawardumamponmababatidtutorialsdisappointlazadagumantimontrealgagavaccinescongratsnanlilisikperseverance,wesleymagpapigilbehindcampnatagoshiplupainmalapadnapakatakawtumayonagbasacometiktok,joshuatangeksgraphicindividualvictoriamagdalanakatinginhanapbuhaywordkailanreboundagam-agamhawaiinagsusulputankombinationtandangpinabayaanmahalagacompletamentepanahondoonnagpasensiyasahodcreatedtaga-suportanobelaoraspapasokalingnag-aalanganfamilyinutusanbeybladenaghuhumindigsubalitharapreachpag-unladmagkakaanakmagturoniyangbalancesganidnaturtakbonakaangatpinanalunanmagpaki-translatenagpasamatutubuinamoypaparamihistoriatumubotamaanresignationmaykasawiang-paladmakapagpahingagovernorsunti-untikampeonskabthalu-haloexhaustionmulaltotanawinexportkalawangingparangsurroundingsnegativetangingmakalabasplayedsumuwaytheserosariosaleskaguluhanlaromapadaliikawnalalabingelectionspinanawaninformationindividualssilalumagoklasejosienanaisingananglamang-lupamunastartnag-isipmananagoteksempelmatitigaskanayondriverpilapayonamamanghalightklasengkagabipapansinintenersystematisksomesigningsshutnapakasinungalingboxumaalispinapakinggannakasandignakakaalamminamahalmariang