Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

33 sentences found for "use"

1. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

2. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

3. Analog oscilloscopes use cathode ray tubes (CRTs) to display waveforms.

4. Cancer is caused by a combination of genetic and environmental factors, such as tobacco use, UV radiation, and exposure to carcinogens.

5. Chatbots and virtual assistants are examples of AI applications that use natural language processing to interact with users.

6. Confocal microscopes use laser technology to create 3D images of small structures.

7. Effective use of emphasis can enhance the power and impact of communication.

8. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

9. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

10. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

11. He was also a pioneer in the use of strength and conditioning techniques to improve martial arts performance

12. Jangan sampai disayang, manfaatkan waktu dengan baik. (Don't waste it, make good use of your time.)

13. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

14. Many companies use the stock market to raise capital by issuing new shares of stock to investors.

15. Many schools and universities now use television as a way to provide distance learning

16. Modern civilization is based upon the use of machines

17. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

18. Scissors can have straight blades or curved blades, depending on the intended use.

19. She does not use her phone while driving.

20. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

21. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

22. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

23. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

24. The rise of digital currencies and payment systems is changing the way people use and think about money.

25. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

26. The use of emphasis is influenced by cultural and social norms.

27. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

28. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

29. The widespread use of the telephone has had a profound impact on society

30. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

31. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

32. They are a great way to use up leftover ingredients and reduce food waste.

33. When we read books, we have to use our intelligence and imagination.

Random Sentences

1. Magkita tayo bukas, ha? Please..

2. Jeg har fået meget værdifuld erfaring gennem min karriere.

3. Hvis du vil have en chance for at nå toget, skal du virkelig skynde dig. (If you want a chance to catch the train, you really need to hurry.)

4. The credit card statement showed unauthorized charges, so I reported it to the bank.

5. Some people have a sweet tooth and prefer sweet flavors over others.

6. Dogs can develop strong bonds with their owners and become an important part of the family.

7. El discurso del político está llamando la atención de los votantes.

8. Gracias por todo, cuídate mucho y nos vemos pronto.

9. Las hierbas de provenza son una mezcla de distintas hierbas secas, ideales para condimentar platos.

10. Sa aming mga paglalakbay, nakakita kami ng mga kapatagan na mayabong na mga pastulan.

11. Dapat pinakamasaya ang Sabadong ito sa lahat ng Sabado.

12.

13. Yes Sir! natatawa pa ako saka ko binaba yung tawag.

14. Ang mga dentista ay mahalagang propesyonal sa pangangalaga ng ngipin at bibig, at mahalagang sumunod sa mga payo at rekomendasyon nila upang maiwasan ang mga dental problem.

15. Paliparin ang kamalayan.

16. Hello. Magandang umaga naman.

17. Sinimulan ko ng basahin sa entry kung saan nakabuklat.

18. Tantangan hidup juga dapat mengajarkan kita tentang nilai-nilai seperti kesabaran, rasa syukur, dan ketekunan.

19. Protecting biodiversity is important for the health of ecosystems and the survival of many species.

20. Está claro que la situación ha cambiado drásticamente.

21. Sa paghahanap ng solusyon sa mga palaisipan, mahalaga ang tamang pag-iisip, pag-aaral, at eksperimentasyon.

22. Nagkakaroon ng pagdiriwang sa Batangas tuwing ika-23 ng Hulyo sa pag-alala kay Apolinario Mabini.

23. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

24. Kung may tiyaga, may nilaga.

25. Maaga kaming nakarating sa aming pupuntahan.

26. La agricultura es una actividad fundamental en muchas regiones del mundo.

27. Promise yan ha? naramdaman ko yung pag tango niya

28. Las escuelas se dividen en diferentes niveles, como primaria, secundaria y preparatoria.

29. Hindi ko mapigilan ang aking mga titig sa aking nililigawan dahil sobrang ganda niya.

30. En Argentina, el Día de San Valentín se celebra en el mes de julio.

31. El internet ha hecho posible la creación y distribución de contenido en línea, como películas, música y libros.

32. Dialog antaragama dan kerja sama antarumat beragama menjadi penting dalam membangun perdamaian dan keharmonisan di tengah keragaman agama.

33. Mahilig maglaro ng video games si Marvin.

34. Pumupunta siya sa Maynila bawat buwan.

35. Oo, malapit na ako.

36. Ipagtimpla mo ng kape ang bisita.

37. Las labradoras son muy activas y necesitan mucho ejercicio diario.

38. Tumututol ako sa kanilang plano dahil alam kong may mas magandang paraan para matupad ang layunin nito.

39. La science de la météorologie étudie les phénomènes météorologiques et climatiques.

40. Ang mga estudyante ay sumailalim sa isang pagpupulong upang magbahagi ng kanilang mga mungkahi sa paaralan.

41. Mi vecino tiene una labradora dorada que siempre corre a saludarme.

42. The value of cryptocurrency can fluctuate rapidly due to market forces.

43. At tuluyang nagliwanag ang buong paligid at nawala ang dalawa.

44. Omelettes are a popular choice for those following a low-carb or high-protein diet.

45. Mahalagang magkaroon ng emergency fund upang maiwasan ang pagkakaroon ng utang sa panahon ng krisis o emergency.

46. Meskipun tantangan hidup kadang-kadang sulit, tetapi mereka juga dapat memberikan kepuasan dan kebahagiaan ketika berhasil diatasi.

47. Sa gitna ng kaguluhan, natagpuan niya ang kapayapaan sa pag-iisa.

48. Electric cars have lower maintenance costs as they have fewer moving parts than gasoline-powered cars.

49. Salud por eso.

50. Magic Johnson was a skilled playmaker and led the Los Angeles Lakers to multiple championships.

Similar Words

MassachusettsExcusehouseusedcauseshouseholdsmisusedJailhousehousehold

Recent Searches

usemakikitadiscoveredsapatbipolarbluesmag-usapmatulunginmagtatakanagkabungapakistanbigkispinabayaanmagsaingmarieonlymagbasakumustangangalingfatalipagbilinabigaypusongpatongumiisoddarnatataasnapiliydelserpusobernardomesatapusinmahiwagangmagsasalitakinaiinisandawamazonaanhinneedlessdemlilikotuhodpioneerstuffedbroadcastresearch,mrsonebalahibopaniwalaanpagtayoakomarahangopportunitiesproducepermitenhingalbusilaktelephoneumupoincredibleminutemaluwagsantousoipinangangakpancitmabutinghalthumakbangmaghihintaysamakatuwidkonsiyertomicapoolmultonakukuhacultivaraccuracylolaculturabutmapakalianakipinaalamriyaniwanancommercialdyippumasokiyakclearspanakaririmarimgobernadormatatalinonakakamanghalugawpoliticsnabuoheartbreaklawaymamimissmatagumpayibinaonlumabanmagpa-ospitalekonomiyamapayapaunakatandaankilongmininimizejackykangpagpapakainmanymangiyak-ngiyakmaximizingsadyangmataliksementeryotumatawaddiseasenamissnararapatexcitedliablemalilimutanmagkakapatidtungkodpanamapaghaharutanmalalakinagbanggaanlintabeastgayunpamanpagkakakawitkirbypulisnakakunot-noongnagkantahanharap-harapangfremstillenagkakasyaventapinakamaartengganangenergyleadnahihirapanitinanimpagtatanimmakitangsaranggolalakingaparadornagdvdipagtanggolhumahabanagpatulongquezonnatinagnakakapamasyalenerginagbiyayamakapagpahingabintananamtutorialstabinglittlewaritabing-dagatberetibahay-bahayannagsasanggangpagkakalutobataymangungudngodretirarkumalantogkasamanakituloghinalungkatsarilinginiuwimahabareviewersnakaimbakclassroomgagamitinexpeditedipinalutonakiramayscientist