Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

33 sentences found for "use"

1. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

2. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

3. Analog oscilloscopes use cathode ray tubes (CRTs) to display waveforms.

4. Cancer is caused by a combination of genetic and environmental factors, such as tobacco use, UV radiation, and exposure to carcinogens.

5. Chatbots and virtual assistants are examples of AI applications that use natural language processing to interact with users.

6. Confocal microscopes use laser technology to create 3D images of small structures.

7. Effective use of emphasis can enhance the power and impact of communication.

8. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

9. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

10. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

11. He was also a pioneer in the use of strength and conditioning techniques to improve martial arts performance

12. Jangan sampai disayang, manfaatkan waktu dengan baik. (Don't waste it, make good use of your time.)

13. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

14. Many companies use the stock market to raise capital by issuing new shares of stock to investors.

15. Many schools and universities now use television as a way to provide distance learning

16. Modern civilization is based upon the use of machines

17. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

18. Scissors can have straight blades or curved blades, depending on the intended use.

19. She does not use her phone while driving.

20. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

21. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

22. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

23. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

24. The rise of digital currencies and payment systems is changing the way people use and think about money.

25. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

26. The use of emphasis is influenced by cultural and social norms.

27. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

28. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

29. The widespread use of the telephone has had a profound impact on society

30. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

31. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

32. They are a great way to use up leftover ingredients and reduce food waste.

33. When we read books, we have to use our intelligence and imagination.

Random Sentences

1. Fathers can also play an important role in teaching life skills and values to their children.

2. Libro ko ang kulay itim na libro.

3. Magaling maglaro ng chess si Joseph.

4. Kahit malilimutin si Mia, sinisikap niyang ayusin ang kanyang schedule para maging maayos ang kanyang araw.

5. Les travailleurs peuvent changer de carrière à tout moment de leur vie.

6. Pinakamatipid kong pagkain ay noodles, pero kailangan ko pa rin ng kubyertos.

7. Decaffeinated coffee is also available for those who prefer to avoid caffeine.

8. Gawa/Yari ang Tshirt sa Tsina.

9. He was hospitalized for pneumonia and was on a ventilator for several days.

10. Some countries have abolished the monarchy, while others continue to have kings or other types of monarchs.

11. "Let sleeping dogs lie."

12. The United States also has a system of governors, who are elected to lead each individual state

13. Pinagsabihan siya ng guro dahil napansin ang kanyang pagiging maramot sa mga kaklase.

14. She studies hard for her exams.

15. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

16. Tantangan hidup juga dapat menginspirasi inovasi, kreativitas, dan pemecahan masalah.

17. Esta comida está demasiado picante para mí.

18. Limitations can be a source of motivation to push oneself to achieve more.

19. Cryptocurrency has faced regulatory challenges in many countries.

20. Gawa ang palda sa bansang Hapon.

21. May isang umaga na tayo'y magsasama.

22. Sang-ayon ako na kailangan nating magtulungan upang malutas ang mga suliranin ng ating lipunan.

23. Les soins de santé de qualité sont un droit fondamental de chaque individu.

24. Habang naglalakad sa gabi, nabigla siya sa biglang pagkabagsak ng mga paputok.

25. Buksan ang puso at isipan.

26.

27. Hindi ko ho kayo sinasadya.

28. Ang tubig-ulan ay nagbibigay ng natural na tubig sa mga lawa at ilog, na nagbibigay ng tahanan at pagkain sa mga isda.

29. Binabati ko ang aking kaibigan sa kanyang bukas palad na pagtulong sa akin sa aking panahon ng pangangailangan.

30. Omelettes are a popular choice for those following a low-carb or high-protein diet.

31. Bumisita kami sa mga kaibigan namin sa kanilang bahay sa hatinggabi.

32. Television is a medium that has become a staple in most households around the world

33. La falta de acceso a tierras y recursos puede ser un desafío para los agricultores en algunas regiones.

34. Kapag dapit-hapon, masarap kumain ng merienda habang nagmamasid sa sunset.

35. Sa pag-aaral ng mga palaisipan, mahalagang maging mapanuri at malikhain upang malutas ang suliranin.

36. How I wonder what you are.

37. Bakit lumilipad ang manananggal?

38. Maraming paaralan at kalsada ang binigyan ng pangalan ni Mabini sa buong bansa.

39. Les riches dépensent souvent leur argent de manière extravagante.

40. Ang mga pangarap natin ay nagtutulak sa atin upang magkaroon ng mga positibong pagbabago sa buhay.

41. Pakibigay mo ang mangga sa bata.

42. He has been building a treehouse for his kids.

43. Storm can control the weather, summoning lightning and creating powerful storms.

44. Pahiram ng iyong sasakyan, wala akong ibang masasakyan pauwi.

45. Hay naku, kayo nga ang bahala.

46. I am writing a letter to my friend.

47. Tumagal ng tatlong oras ang kanyang operasyon.

48. We sang "happy birthday" to my grandma and helped her blow out the candles.

49. Si Emilio Aguinaldo ang pinakamatandang nabuhay na pangulo ng Pilipinas, na namatay sa edad na 94.

50. Hindi nya masikmura ang harap-harapang panloloko ni mayor sa kanyang nasasakupan.

Similar Words

MassachusettsExcusehouseusedcauseshouseholdsmisusedJailhousehousehold

Recent Searches

uselegacyletterbatangcongressmabuhaynakakatakotnapagtuunan00ampagbabantahamonbakantemagka-apoabovetabingmarumistatingmahalpagkuwacosechar,pagbatiandyanmotionnapupuntabagkus,kumalantogsinkwalangpinahalataparkengayondalirishipbornpusosalarinnyasayonapatakbomag-ingatsinasadyatumatawakakaroonpagkainismuchasino-sinonutrientsnovellesegenconkoryentetumatakbocandidatesmagkakapatidhinaoffentligetumubomungkahilapisgenerositytakepalabasselladobosarilingpalitanfaultdembeyondimprovementcultivoeksamenhomenapakasinungalingvideos,kapainkawili-wilipakukuluannag-alalanakaka-bwisitsulyapnakakitafilipinaparaisosubalitipinagdiriwangsmokebalangstorelangyanakarinignatataposhandaankumainmoviesnamasyalyoungpinatiramalezahigh-definitionjeromepeepiniintaynasisiyahandahannaniniwalanapadpadfotostubig-ulanbasketballumanopamilyapagkaganda-gandapinoypinaghihiwasumuotkawalmasimportanteskakaibangkinagagalakhumahagoknakuspentkaagadninumanyoutube,nakakadalawpaki-chargemahusaybutterflygermanybigraiselumipattwinklepamamalakadfeelingnitoincomeneronakapagusapvibrateeconomytomarpisoganitomayabongcomunesbakadaanhmmmoverfindiigibbaldelinyadonehinabakasiyahanpakikipagtagponiyanhindelumangoytatawagbusloriquezahumahangoswestkauntituwangdatapwatskilllumbaydumaramimayabangitslalabhanledbaginiindaestariniangatgiveraidmakuhakatibayangdesisyonanpitoobstacleskamandagbilihinkasamaotsoeyekalyepinasokspecialekonomiyapesos