Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "mag-iipon"

1. "Wag kang mag-alala" iyon lang ang sagot ng dalaga sa kanya

2. Ako ay sobrang gutom, bagkus ako ay mag-aantay na lang ng hapunan mamaya.

3. Ang abilidad na mag-isip nang malikhain ay nagbibigay daan sa paglutas ng mga problema.

4. Ang bawat paaralan ay nag-aapuhap ng mga donasyon para sa bagong aklat at kagamitan ng kanilang mga mag-aaral.

5. Ang galing nyang mag bake ng cake!

6. Ang haba na nang bigote mo, mag ahit ka nga!

7. Ang kahusayan ng isang guro ay dapat na itinuring at kilalanin ng mga mag-aaral.

8. Ang kelangan mo na lang gawin ay mag dasal..

9. Ang mag-aaral ay nagsusulat ng mga sanaysay at mga ulat bilang bahagi ng kanilang mga proyekto.

10. Ang mag-asawa ay may hanapbuhay na paghahabi ng mga tela.

11. Ang mahiwagang pagsagot ng prinsipeng tila ba mag agam-agam.

12. Ang mga dentista ay maaaring mag-rekomenda ng mga produkto na dapat gamitin upang mapanatili ang malusog na ngipin.

13. Ang mga engineer nagsisilbi upang mag-disenyo at magtayo ng mga imprastraktura para sa publiko.

14. Ang mga guro ay humingi ng mga mungkahi mula sa kanilang mga mag-aaral upang mapabuti ang kanilang pagtuturo.

15. Ang mga mag-aaral ay nag-aapuhap ng karagdagang oras para mag-ensayo para sa kanilang mga pagsusulit.

16. Ang mga mamamayan sa mga lugar na mayaman sa tubig-ulan ay dapat mag-ingat sa pagtatapon ng basura upang maiwasan ang pagbabara ng mga daluyan ng tubig.

17. Ang mga paaralan ay maaaring magpakalat ng kamalayan sa mga mag-aaral tungkol sa panganib ng paggamit ng droga.

18. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magpakasaya at mag-enjoy sa buhay.

19. Ang pagguhit ay isang paraan upang mag-relax at magpakalma.

20. Ang pagkakaroon ng maayos na usapan ay nagpawi ng mga alinlangan sa pagitan naming mag-asawa.

21. Ang pagtawanan at mag-enjoy kasama ang mga kaibigan ay isang nakagagamot na aktibidad.

22. Ang pagtuturo ng mga guro ay nagpapalaganap ng kaalaman at abilidad sa mga mag-aaral.

23. Ang takip-silim ay isang magandang panahon para mag-unwind at mag-isip-isip sa mga bagay-bagay.

24. Ate, gusto ko sanang mag-isa.. ok lang ba?

25. Ayaw niya sanang ipaalam ito sa iyo dahil ayaw niyang mag-alala at maawa ka sa kanya.

26. Bawal mag-abuso ng kapangyarihan dahil ito ay isang krimen.

27. Bawal mag-drugs dahil ito ay nakakasama sa kalusugan at nakakadulot ng krimen.

28. Bawal mag-ingay sa loob ng liblib na lugar dahil ito ay nakakabulahaw sa mga hayop.

29. Bawal mag-smoke sa loob ng opisina dahil sa panganib na dulot ng usok sa kalusugan ng ibang tao.

30. Bilang isang guro, mahalaga ang aking kamalayan sa mga pangangailangan ng aking mga mag-aaral upang magtagumpay sila sa kanilang pag-aaral.

31. Bumaba ako sa basement ng bahay at nagitla ako nang biglang mag-on ang ilaw.

32. Busog pa ako, kakatapos ko lang mag merienda.

33. Bye! liliko na sana ako para mag-iba ng exit.

34. Dahil sa hiya, tuwing gabi na lamang ito mag-isang lumilipad upang humanap ng kanyang makakain.

35. Dapat tayong mag-ingat sa sobrang pangamba dahil ito ay maaaring makaapekto sa ating kalusugan.

36. Doon nila ipinasyang mag honeymoon.

37. Gayunpaman, ang kapintasang iyon ay hindi nakikita ng mga tao dahil sa kagandahag loob na ipina mamalas ng mag-asawa.

38. Gusto ko na mag swimming!

39. Gusto ko pang mag-order ng kanin.

40. Gusto kong mag-order ng pagkain.

41. Habang maliit pa ang bata ay itinuro na ng mag-asawa kung paano ang humabi.

42. Halos dalawang linggong nag quarantine ang pamilya ni Josie matapos mag positibo sa covid.

43. Halos nakalimutan na ng mag-asawa ang nangyari sa diwata.

44. Hindi ko alam kung saan ito mag-uumpisa, pero may gusto ako sa iyo.

45. Hindi ko maintindihan kung bakit may mga taong ganito mag-isip.

46. Hindi lahat ng tao ay bukas palad, kaya kailangan mong mag-ingat sa mga taong pwede kang masaktan.

47. Hindi mo na kailangan mag-isa dahil ako ang iyong kaulayaw.

48. Hindi naman natuwa ang mga estudyante sa pagkakaroon ng reshuffling dahil kailangan nilang lumipat ng silid-aralan at mag-adjust ulit sa kanilang mga kaklase.

49. Hindi niya inaasahan na mag-iwan ng malaking marka sa kanyang komunidad ang kanyang paglilingkod.

50. Hindi pangkaraniwang araw ito at kinakailangang magkaroon silang mag-anak ng hindi pangkaraniwang pananghalian.

51. Hinugot niya ang kanyang cellphone upang mag-reply sa aking mensahe.

52. Hiramin mo ang aking guitar para mag-practice ng kantang ito.

53. Huwag kang mag-focus sa kababawan ng isang tao, tingnan mo ang kanyang kalooban.

54. Inalagaan ng mag-asawa ang halaman at nang lumaki ay nagkabunga.

55. Inisip ko na lang na hindi sila worth it para hindi ako mag-inis.

56. Isang araw, kararating pa lang ng mag-asawa mula sa pagtitinda ng gulay, galing sa kuwarto ay lumabas si Aya at hiningi ang ipinagbiling prutas.

57. Kahit hindi ka magaling sa pagguhit, puwede ka pa ring matuto at mag-improve sa pagguhit.

58. Kailangan mong mag-isip nang malalim upang makita mo ang kaibuturan ng kanyang problema.

59. Kailangan nating mag-ingat sa kalusugan upang maiwasan ang mga sakit, samakatuwid.

60. Kailangan nating magbigay ng halaga sa mga kababawang bagay upang mag-enjoy sa buhay, pero hindi dapat ito maging priority.

61. Kapag dapit-hapon, masarap mag-jogging dahil mas malamig na ang panahon.

62. Kapag dapit-hapon, masarap mag-relax sa veranda habang nanonood ng sunset.

63. Kapag mayroon kang kaulayaw, hindi ka mag-iisa sa mga pagsubok na iyong kinakaharap.

64. Kapag nasa agaw-buhay na sitwasyon, kailangan nating mag-ingat at magtulungan para sa ating kaligtasan.

65. Labis na ikinatuwa ng mag-asawa ang biyayang ito,pangalanan nila ang bata na Rabona, pinaghalo ang pangalan ni Rodona at ang bundok ng Rabba.

66. Lumakad ako nang mag-isa sa madilim na daan at nagitla ako nang biglang may humawak sa aking balikat.

67. Mag asawa na kayo pero hindi mo pa nasasabing mahal mo siya?

68. Mag de-dekorasyon kami mamaya para sa kanyang 18th birthday.

69. Mag o-online ako mamayang gabi.

70. Mag-aaral ako ngayon, datapwat sa hapon ay pupunta ako sa doktor.

71. Mag-aaral ako sa unibersidad sa susunod na taon.

72. Mag-babait na po siya.

73. Mag-iikasiyam na nang dumating siya sa pamilihan.

74. Mag-ingat sa aso.

75. Mag-usap tayo sa WhatsApp o Line.

76. Mag-uusap kami sa makalawa ng tanghali.

77. Magandang ideya ang magbakasyon, datapwat kailangan ko munang mag-ipon.

78. Mahalagang mag-ingat sa ating kalusugan, datapapwat ay hindi natin nakikita ang mga mikrobyo at virus na nagdadala ng sakit.

79. Mahusay mag drawing si John.

80. Marahil ay dapat kang mag-isip-isip muna bago magdesisyon sa mga bagay-bagay.

81. Marahil ay hindi magandang ideya na maglakad mag-isa sa madaling araw.

82. Marahil ay nagpaplano ka na ng susunod mong bakasyon kaya't dapat kang mag-ipon.

83. Masakit man aminin, hindi maiiwasan na mag-inis tayo sa mga taong nakapaligid sa atin.

84. Masarap mag-surfing sa dapit-hapon dahil mas malamig na ang dagat.

85. Matapos ang matagal na relasyon, napagpasyahan niyang mag-iwan at mag-move on.

86. Minsan, ang pag-iisa ay maaaring maging magandang oportunidad para mag-isip at magpahinga.

87. Nagdesisyon siyang mag-iwan ng trabaho upang magtayo ng sariling negosyo.

88. Naging mayaman din ang mag-anak dahil sa mga bentang tela na ginagawa ng bata.

89. Nagitla ako nang biglang mag-ding ang doorbell nang walang inaasahan.

90. Nagkatinginan ang mag-ama.

91. Nagsagawa ng ritwal si Matesa upang sumpain ang anak ng mag-asawa.

92. Nagsisimula akong mag-exercise sa hatinggabi para sa aking kalusugan.

93. Nagsusulat ako ng mga liham ng aplikasyon upang mag-apply sa trabaho o scholarship.

94. Nais niyang mag-iwan ng sulat para sa kanyang mahal.

95. Naisip niyang mag-iwan ng masamang karanasan sa likod at simulan ang panibagong buhay.

96. Nakakatakot maglakad mag-isa sa hatinggabi sa isang hindi kilalang lugar.

97. Nakasabit ang mga larawan ng mga nangungunang mag-aaral sa silid-aralan upang bigyan ng inspirasyon ang mga bata.

98. Nang mag-asawa ang mga kapatid ni Psyche, humingi siya ng payo kay Apollo kung sino ang dapat mapangasawa niya.

99. Nang magkaharap ang mag-ama, ang kanyang ama ay hindi niya ito tinanggap

100. Nanggaling ako sa isang malakas na liwanag papunta sa pagdidilim ng gabi, kaya't nahirapan akong mag-adjust sa aking paningin.

Random Sentences

1. Les soins de santé de qualité sont un droit fondamental de chaque individu.

2. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

3. Nous avons prévu une lune de miel en Italie.

4. Nagbasa ako ng libro sa library.

5. Alles Gute! - All the best!

6. El arte puede ser utilizado para transmitir emociones y mensajes.

7. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

8. Gaano katagal po ba papuntang palengke?

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

10. Magdamagan silang nagtrabaho sa call center.

11. Kumain ako sa kapeterya kaninang tanghali.

12. Mabuti pa makatayo na at makapaghilamos na.

13. Napakabango ng sampaguita.

14. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

15. The acquired assets will improve the company's financial performance.

16. May pitong taon na si Kano.

17. Ang mais ay tumutubo nang mabuti sa lugar na may malaking access sa araw at sapat na kahalumigmigan

18. Balak kong magluto ng kare-kare.

19. She has written five books.

20. Mayroong proyektor sa silid-aralan upang mas maipakita ang mga visual aids sa pagtuturo.

21. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

22. Yan ang totoo.

23. The player who has the ball is called the "offensive player," and the player guarding him is called the "defensive player."

24. Anong oras natutulog si Katie?

25. Kanina pa siya ganyan kuya.. parang ang lalim ng iniisip.

26. Bilang diwata ay wala siyang kapangyarihang magdugtong ng buhay, datapuwa ang magbigay ng panibagong buhay sa bagong anyo ay kanyang magagawa.

27. Kumanan kayo po sa Masaya street.

28. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

29. Emphasis is often used in advertising and marketing to draw attention to products or services.

30. Protecting the environment involves preserving natural resources and reducing waste.

31. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

32. Sueño con tener un estilo de vida saludable y activo. (I dream of having a healthy and active lifestyle.)

33. Naging mayabong ang kaalaman ng tao dahil sa teknolohiya.

34. Kapag nagkakaroon ng sakuna, ang mga volunteer ay nagiigib ng tubig para sa mga apektadong pamilya.

35. The information might be outdated, so take it with a grain of salt and check for more recent sources.

36. Mga mangga ang binibili ni Juan.

37. I have never eaten sushi.

38. Si Josefa ay maraming alagang pusa.

39. Medarbejdere skal overholde arbejdstider og deadlines.

40. La obra del artista produjo reacciones diversas entre los críticos.

41. Wow, talaga? Para kayong vampires, sa gabi nabubuhay.

42. They are not singing a song.

43. Trapik kaya naglakad na lang kami.

44. Taking a vacation to a beautiful location can create a sense of euphoria and relaxation.

45. Huminga ka ng malalim at tayo'y lalarga na.

46. Ang tubig-ulan ay maaaring magdulot ng pagkakasakit kung hindi magiging maingat sa pag-inom nito.

47. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

48. Eksport af grøn energi er en vigtig del af den danske eksportstrategi.

49. Sigurado ka? Hala! Mag-order ka rin ng burger at fries!

50. Tengo dolor de articulaciones. (I have joint pain.)

Recent Searches

mabibingipotaenaparisukathumalosalaminteknologimaghapongpauwipaamaliksikapataganbuhokbyggethmmmmaalwangtatawaganpunong-punomaliitandrewlalakadpamilihang-bayanlagaslasmarketplacesfourpinaladmahinangipinculpritmagpa-paskobinibinichumochosmagingpagmasdankumalatkalabawadverselybasketballkanilakitabinasadoonmagpa-ospitalengkantadanagmamadalitagaakinmamalascongratswhilepwedengdurianpasankaniyakumidlatsimplengkwenta-kwentabringkolehiyobitbitnawawalaseryosongmatandanapilicommander-in-chiefbihasamababangisknowspamilyatablekayamaghaponpundidokarwahengangheliyannahintakutansolidifybagamakalayaanlumampasnyamasipaglabanartificialnaglalabamanatilisang-ayoniba-ibangsabermagandapleasenatandaanpang-araw-arawbulaklakgirlbayarancallunawarinaliligomaingataywanmabihisanhinahanapbabaengpalaisipansinulidnumerosasrebolusyonmedya-agwamarketingkasingprobablementepaghahanapbumagsakneronilapitanmagkanobukaskaugnayansagabalmiyerkulespatiiskedyulpuedesnaghihinagpisnapapansinnagliliwanagmatchingnaibibigayutilizamaglinissiyang-siyamalihismaglalaronatinagdinalagooglegawanakitulogtinanggappunong-kahoymahigpitkahaponpadabogpalibhasapaladnangahasnagdiretsosawsawanviewspagkamanghapahahanapzoomagawalubospagkataopanginoonnakakuhapagpilinararapatbalitalalotayomagnakawpaglalabaabenagawainhawakantsaapramiskasamaadvancenaglaonsesamemakahihigitsinunud-ssunodpagkakatayocigarettesnasuklammatsingcongressallowinggospelhangaringdoingfalljanelalabhannanlilisikpalawanpaslitenviarlabinsiyamkantulongparkegupitipapaputolpara