Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "crucial"

1. A pesar de su mala reputación, muchas serpientes son inofensivas para los seres humanos y desempeñan un papel crucial en la naturaleza.

2. El agua desempeña un papel crucial en el funcionamiento de los ecosistemas.

3. El papel del agricultor en la sociedad es crucial para garantizar la seguridad alimentaria.

4. However, the quality of the data used to train AI algorithms is crucial, as biased or incomplete data can lead to inaccurate predictions and decisions.

5. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

6. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

7. It's crucial to pay off your credit card balance in full each month to avoid interest charges.

8. Jouer de manière responsable et contrôler ses habitudes de jeu est crucial pour éviter des conséquences graves.

9. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

10. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

11. They play a crucial role in democratic systems, representing the interests and concerns of the people they serve.

12. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

Random Sentences

1. Sa iyong pagdating, lumiwanag ang aking mundo.

2. I learned early on that there's no such thing as a free lunch - everything comes with a cost.

3. Pang-isahang kuwarto ang gusto niya.

4. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

5. Magsisine kami sa makalawa ng hapon.

6. Maaari mo ng bitawan ang girlfriend ko, alam mo yun?

7. Dahil kung anong ganda ng katawan ay siya namang pagkaimpakto ng mukha.

8. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

9. Nagtatrabaho ako sa Manila Restaurant.

10. Las hojas de eucalipto se utilizan a menudo para aliviar la congestión nasal.

11. Parang ganun na nga babes. Tapos tumawa kami.

12. Hindi maunawaan ni Bereti ngunit eksayted siya sa buhay nina Karing.

13. A lot of laughter and joy filled the room during the family reunion.

14. Dapat niyo akong pagsilbihan dahil dito.

15. They have donated to charity.

16. Banyak pemilik kucing di Indonesia juga menjaga kebersihan kandang atau tempat tinggal kucing mereka.

17. Gaano ka kadalas pumunta sa doktor?

18. Ilang gabi pa nga lang.

19.

20. They have already finished their dinner.

21. Sino ang bumisita kay Maria?

22. Alam ko na mayroong magandang intensyon ang kanilang plano, ngunit hindi ako sang-ayon dito kaya ako ay tumututol.

23. Sa lipunan, ang pagiging marangal at matapat ay dapat na itinuturing at pinahahalagahan.

24. Nagliliyab ang mga damo sa bukid dahil sa sobrang init ng panahon.

25. Nagdulot ng kakulangan sa tubig ang matagal na tagtuyot sa kanilang lugar.

26. Ano ang inireseta ng doktor mo sa iyo?

27. A couple of phone calls and emails later, I finally got the information I needed.

28. Menghabiskan waktu di alam dan menjalani gaya hidup yang sehat dapat meningkatkan perasaan kebahagiaan.

29. Pinagpalaluan ang Kanyang karunungan.

30. Emphasis can be used to persuade and influence others.

31. Emphasis can also be used to create a sense of urgency or importance.

32. Gracias por darme la oportunidad de aprender y crecer.

33. El coche deportivo que acaba de pasar está llamando la atención de muchos conductores.

34. Gaano ka kadalas kumain ng baboy?

35. Kapag may tiyaga, may nilaga.

36. Matapang si Andres Bonifacio.

37. Pinuri umano ng mga eksperto ang bagong teknolohiyang inilunsad ng mga siyentipiko.

38. Sa palaruan, maraming bata ang nag-aagawan sa isang bola.

39. Si Carlos Yulo ang unang Filipino gymnast na nakakuha ng gintong medalya sa World Championships.

40. She exercises at home.

41. Hindi nakagalaw si Matesa.

42. She has been preparing for the exam for weeks.

43. Nice meeting you po. automatic na sabi ko.

44. Ang lilim ng kanyang payong ay nagsilbing proteksyon sa kanya mula sa matindi at biglang pag-ulan.

45. Las heridas que no sanan o empeoran con el tiempo pueden ser signo de una enfermedad subyacente y deben ser evaluadas por un médico.

46. Hinawakan ko yung tiyan ko, Konting tiis na lang..

47. Ang pag-asa ay nagbibigay ng mga solusyon sa mga problema at hamon sa buhay na hindi magagawan ng paraan.

48. Forgiveness is a virtue that promotes peace, healing, and a greater sense of connection with ourselves and others.

49. Kapag hindi ka tumigil sa paggamit ng droga, magdudulot ito ng mas malalang kahihinatnan sa hinaharap.

50. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

Recent Searches

imbescrucialkapamilyaisulatsaritasiniyasatmahiwagasementodespuesginaganapisasamagarbansospaglingonngitidiniginaabotkisapmatanagsilapitngipingkamalayancashbibigyanhinampashihigitasahanlastalentedbookstuluy-tuloynalakiiskedyulaaisshrolandsinamaatimcocktailnatitiratawananlazadadesarrollarself-defensetasagrocerypromotelihimstreettigilisamatokyoangalbumilitibigmakinangmayamangbutchbigyanrestaurantinatakepangalantamawidelynakapangasawanaramdamguhitbatokbutihingdietwariipapaputolnag-aalanganbilugangbankburdenpangungutyastopbumahadalandandiamondfiaexcuseresignationinantokpaamamitekstmaramibilispumuntachoicegenerosityfatalrestdidingpapuntascheduletsaasumalamaglutoiwinasiwasqualitytoolpotentialsofatiyaresponsibletrainingkaninaliablebasketbolnagagandahanmakilingverdenbumabaipinagdiriwangpakilutonakaraangnapaluhalitsonimportanteparaanspansfeedbackactivityisinaboybopolsharappuedeairplanessasamapinatirahangaringconsidermallconvey,sipadropshipping,systempneumoniaprofessionalmaglinisamazonlumagoelementarycaraballoiintayinbringingdisenyongmedgumagalaw-galawhatinggabidiaperipabibilanggonagpabotagricultoresnakakatawagobernadortabing-dagatnagkakatipun-tiponpagkabiglapinapataposmaisusuotnovellesmakatatlopaki-chargemakalipasfestivalespaga-alalamagpaliwanagkalakihanhinagud-hagodsalamangkerobangladeshsalu-salonangangahoypagkasabimakahingimahahawatreatsmensajes2001buung-buolumiwagpagkuwanaglalaroumiiyakmamalasmagpahabakumakainmalawakbrancher,nalalabingmanatilihayaangmasaktankanyasanggolmamahalinenviarumiimikpagbigyan