Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "crucial"

1. A pesar de su mala reputación, muchas serpientes son inofensivas para los seres humanos y desempeñan un papel crucial en la naturaleza.

2. El agua desempeña un papel crucial en el funcionamiento de los ecosistemas.

3. El papel del agricultor en la sociedad es crucial para garantizar la seguridad alimentaria.

4. However, the quality of the data used to train AI algorithms is crucial, as biased or incomplete data can lead to inaccurate predictions and decisions.

5. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

6. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

7. It's crucial to pay off your credit card balance in full each month to avoid interest charges.

8. Jouer de manière responsable et contrôler ses habitudes de jeu est crucial pour éviter des conséquences graves.

9. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

10. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

11. They play a crucial role in democratic systems, representing the interests and concerns of the people they serve.

12. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

Random Sentences

1. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

2. Pneumonia can be prevented with vaccines and by maintaining good hygiene.

3. Sa pagkawala ng kanilang tahanan, naghihinagpis ang mga pamilyang apektado ng sunog.

4. Nous allons avoir un photographe professionnel pour immortaliser notre mariage.

5. Zachary Taylor, the twelfth president of the United States, served from 1849 to 1850 and died while in office.

6. may butil na rin ng pawis sa kanyang ilong.

7. Hay muchos riesgos asociados con el uso de las redes sociales, como el acoso cibernético.

8. Einstein was also an accomplished musician and played the violin throughout his life.

9. Ang dentista ay propesyonal na nag-aalaga sa kalusugan ng ngipin at bibig.

10. At noon, higit kailanman, naging hamak sila sa pagtingin ng lahat.

11. Pinuri ni Pangulong Rodrigo Duterte si Carlos Yulo matapos ang kanyang tagumpay sa gymnastics.

12. Alles hat ein Ende, nur die Wurst hat zwei.

13. Nagpaluto ako ng spaghetti kay Maria.

14. Ang mga punong-kahoy ay hindi lamang maganda

15. Ang pagtulong sa iba ay isang halimbawa ng kabutihang-loob na pinagsisikapan ng marami na isabuhay araw-araw.

16. She admires the beauty of nature and spends time exploring the outdoors.

17. Nagiging emosyonal ang mga panahon sa kasal, tulad ng mga pananalita ng mga magulang at mga kaibigan.

18. Los héroes nos inspiran a ser mejores y nos muestran el poder de la bondad y el sacrificio.

19. Ice for sale.

20. Maingay ang bagong taon sa Pilipinas.

21. Money can be earned through various means, such as working, investing, and entrepreneurship.

22. Si Rizal ay kilala sa kanyang pagiging makatarungan at pagiging boses ng mga walang tinig sa kanyang panahon.

23. Hindi dapat supilin ng mga magulang ang mga pangarap ng kanilang mga anak.

24. Samantala sa bahay, nagluluto siya ng paboritong putahe ng kanyang asawa.

25. Sa matinding sikat ng araw, tila sya ang mandirigmang sugatan, ngunit matatag na nakatindig sa pinagwagihang larangan.

26. If you think he'll agree to your proposal, you're barking up the wrong tree.

27. Hindi niya inaasahan na mag-iwan ng malaking marka sa kanyang komunidad ang kanyang paglilingkod.

28. Tumama ang siko nito sa kanyang dibdib, sa kanyang katawan! Dali-dali siyang tumalikod at patakbong lumabas.

29. Antiviral medications can be used to treat some viral infections, but there is no cure for many viral diseases.

30. Hiramin ko ang iyong bike para sumali sa cycling event sa Sabado.

31. Sa aking hardin, ako ay nagtatanim ng mga bulaklak.

32. Tumahol ang aso at natakot ang pusa.

33. A wife is a female partner in a marital relationship.

34. Nabangga ang kotse ni Juan bandang alas-tress ng hapon.

35. The patient's doctor recommended a treatment plan based on the type and severity of their leukemia.

36. Nakatawag ng pansin ang masama nitong amoy.

37. Patients may be hospitalized for a variety of reasons, including surgery, illness, injury, or chronic conditions.

38. En España, la música tiene una rica historia y diversidad

39. Nakapaglaro ka na ba ng squash?

40. I fell for an April Fool's joke on social media this year - a friend posted a fake news article that was so convincing I thought it was real.

41. Electric cars are part of a larger movement toward sustainable transportation, which includes public transportation, biking, and walking, to reduce the environmental impacts of transportation.

42. The momentum of the economy slowed down due to a global recession.

43. Ako ay sobrang gutom, bagkus ako ay mag-aantay na lang ng hapunan mamaya.

44. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

45. La ingesta adecuada de fibra puede ayudar a regular el sistema digestivo y mantener la salud intestinal.

46. Nang muling lumusob ang higante, pinaulanan nila ito ng pana sa dibdib.

47. La música puede ser utilizada para transmitir emociones y mensajes.

48. At blive kvinde kræver også mod og selvstændighed.

49. Palibhasa ay mahilig mag-aral at magpahusay sa kanyang mga kakayahan.

50. Ahh... haha. Umiling na lang ako bilang sagot.

Recent Searches

crucialmagpaliwanagherramientasnawawalawhileinjuryheartbeatknow-howkusineroculturassuchnaglababilhanpalayogulatpamasahepumayagnanamanguiltypinaulananvednamakahusayangoshsumisideneroblusagenerababingbingbarnesponggawainmagkasinggandababesserioustingcomienzanganyanelvisgranadapakelamcryptocurrency:galitfonoipihitkatiefilmscomplicatedeasiernanayfarofferstudentdevelopmentlearningexpertbehalftaleestateespadanagliliyabpagkalungkotisinulatnakikilalangeskwelahanemphasizedemocionaltinaydyipabundantetinakasandisposalnaglutoprincipalesnabigyankastilangtindahandancepalasyopropesormagisiplabisdaliinintaywakasdahilcuandocharismaticlamesactricaspusadiseasesiwanhinoggabrielconstitutionchristmaschefharmfulbuwalclientesnutrientesestablishumarawsumarapconsiderarmulti-billioncertainbutterflyappanimbutchbumaligtaderrors,bumahamovieaffectamazonbulalasbipolarloob-loobregularmentebestbecomeawitanaraymaglalakadannaangkopamendmentsaksidenteagilityafteradditionally,able1950skarganghonestoresultnagpepekesundhedspleje,nag-iyakansabadongmagkaibigantungawkamiaslumiwanagnakalagaynapalitangmaisusuotnatanongnasulyapanhumalovedvarendesumalakaysipagnegativelipatniyavelfungerendenapakahulingpakisabipromotelivestumangolegislationmagigitingtinikmagtipidvampiresramdamqualitymovingluismaaringprogresslasingmagta-trabahomaalikabokmbalonakakagalamakapangyarihangnagkwentopinaghatidannakapasokpinipilittiktok,linggongmagkasamamelissashowerpakinabanganperpektingturonmatutongtsonggopagkainpahiramsiglo