Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "court"

1. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

2. He appointed three Supreme Court justices during his presidency, shaping the ideological balance of the court.

3. Kevin Garnett was a versatile power forward who brought intensity and defensive prowess to the court.

4. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

5. Off the court, LeBron is actively involved in philanthropy through his LeBron James Family Foundation, focusing on education and providing opportunities for at-risk children.

6. Supreme Court, is responsible for interpreting laws

7. The basketball court is divided into two halves, with each team playing offense and defense alternately.

8. The height of the basket and the court size varies depending on the age and skill level of the players.

9. The king's court is the official gathering place for his advisors and high-ranking officials.

10. The Lakers continue to be a dominant force in the NBA, with a dedicated fan base and a commitment to excellence on and off the court.

11. The Supreme Court is the highest court in the land and has the power of judicial review, meaning it can declare laws unconstitutional

Random Sentences

1. But all this was done through sound only.

2. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

3. Binentahan ni Mang Jose ng karne si Katie.

4. Smoking cessation can lead to improved mental health outcomes, such as reduced anxiety and depression symptoms.

5. Ang pagiging aware at vigilant sa paligid ay mahalaga upang maiwasan ang pagkalat ng droga sa lipunan.

6. Ano ang gustong bilhin ni Juan?

7. Dahil sa bayanihan, naging matagumpay ang aming pagtatanim ng mga pananim sa taniman.

8. Kung hindi ka interesado, okay lang, pero sana pwede ba kita ligawan?

9. The culprit behind the data breach was able to exploit a weakness in the company's security.

10. Napadungaw siya sa entablado at nagulat sa dami ng taong nanood ng kanilang palabas.

11. He's known to exaggerate, so take what he says with a grain of salt.

12. Ang aming mga hardin sa paaralan ay mayabong na tanim na kinakailangan naming alagaan.

13. Hindi mo alam kung maarte siya o hindi dahil hindi siya masyadong nakikihalubilo sa ibang tao.

14. Habang nagluluto, nabigla siya nang biglang kumulo at sumabog ang kawali.

15. Limitations can be cultural or societal, such as gender roles or stereotypes.

16. Cada año, la cosecha de manzanas en esta región es muy buena.

17. She has made a lot of progress.

18. Las heridas en zonas sucias o contaminadas pueden aumentar el riesgo de infección y requerir una limpieza más exhaustiva.

19. Cancer can impact individuals of all ages, races, and genders.

20. Nag-aalala ako para sa kalusugan ko, datapwat hindi pa ako handa para sa check-up.

21. Sa pagkamatay ng aming alagang aso, kami ay lubos na ikinalulungkot.

22. Huh? umiling ako, hindi ah.

23. Tumayo yung limang babae at lumapit kay Kerb.

24. Ang kanyang galit ay parang nagbabaga, handang sumiklab anumang oras.

25. He has learned a new language.

26. She missed several days of work due to pneumonia and needed to rest at home.

27. Ang pagtuturo ng mga guro ay nagpapalaganap ng kaalaman at abilidad sa mga mag-aaral.

28. Nagsisindi ng ilaw ang mga bahay tuwing takipsilim.

29. They go to the movie theater on weekends.

30. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

31. Me siento caliente. (I feel hot.)

32. The patient had a history of pneumonia and needed to be monitored closely.

33. Ang aming kaharian ay hindi kayang marating ng taong may katawang lupa.

34. Representatives often collaborate with other officials and stakeholders to achieve common goals and address broader societal issues.

35. Matagal ko na syang kaibigan sa Facebook.

36. Ignorar nuestra conciencia puede hacernos sentir aislados y desconectados de los demás.

37. Halos lahat ng mga misa sa aming parokya ay may awiting Bukas Palad.

38. Sa bawat tagumpay, dapat tayong magpasalamat at magbigay ng pagkilala sa mga taong tumulong sa atin, samakatuwid.

39. Jeg tror, jeg er ved at blive forelsket i ham. (I think I'm starting to fall in love with him.)

40. Elektronikken i en bil kan hjælpe med at forbedre kørsel og sikkerhed.

41. Mayroong hinahabol na magnanakaw sa kalsada na inaabangan ng mga pulis.

42. Der er mange forskellige former for motion, herunder aerob træning, styrketræning og fleksibilitetstræning.

43. Sa pagdami ng mga tao, ang mga aso ay naging alaga nila sa kanilang mga tahanan.

44. Ang labi niya ay isang dipang kapal.

45. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

46.

47. Ang pagsusuri ng wastong hudyat ay mahalaga sa interaksiyon ng tao at sa pag-unawa ng iba't ibang anyo ng komunikasyon.

48. Lumiwanag ang silangan sa pagsikat ng araw.

49. Muchas personas luchan con la adicción a las drogas y necesitan ayuda para superarla.

50. Naputol yung sentence ko kasi bigla niya akong kiniss.

Recent Searches

productividadadvertising,artistascourtmauupocertainikinakagalitnakainnamataypagpapatubomayamanna-suwaynakakatawamaskinerlarangantinanggapmatatalokalikasanbarangaykasoywideespigasnalangtumiratulangsadyangwikatungoininomunahinmodernemukaspeedpoorerhinatidpatawarinpatonginalokpinyainakalangpeepnaglalatangtumalimbilihintumahanhimselfdakilangmagbagong-anyotignanknowsyumuyukosunud-sunodnapakahusaypambahaybuwalmalihispogimalusogpatihahaipinalutorumaragasangconstant00ampagbebentabathalabairdleukemiasagasaannapagodmakikiligomagsasalitaalasumiilingrebomagsimulawindownagdarasaltapetatlongmasarapnapakabilisnareklamomainstreamcontentlumibotso-calledrelevantpowersnagkakakainnagreplyasignaturakanilabroadcastkapintasangeuphoricmatumaldapathiningapanahonnausalmeanstaga-tungawgymtantananmalambotakinhoweversumayapag-itimmetodisktenidopagimbayfiancee-commerce,pagapanglandetjannailanglumikhamapaikotschoolsnatuwadireksyonkapaginspirasyonfacebooknandayapinapanoodcorrienteslever,miyerkulesnakakapagtakaspellingpinagsanglaanpumikitpanigreplacedmanalokanbedspara-parangkikilosngipingpag-isipanbluekasaganaanyayapagsayoawaniyogbukodskillshumpaynakakuhaellensapatosbiyasnutspaghabaorderinbonifaciosamakatwidkatapatcountlessmagbasaleegtandafestivalessalemichaelnangangakoabangankatedraliphoneayonprutasisinalaysaynagtuturosikrer,kuripotmadurasfotosnoeltumawagtuyonakumbinsikaminakakamitbaranggaybumubulahanapinpagkalipasnapanoodnag-uumirievolveestasyonlending:poot