Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "court"

1. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

2. He appointed three Supreme Court justices during his presidency, shaping the ideological balance of the court.

3. Kevin Garnett was a versatile power forward who brought intensity and defensive prowess to the court.

4. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

5. Off the court, LeBron is actively involved in philanthropy through his LeBron James Family Foundation, focusing on education and providing opportunities for at-risk children.

6. Supreme Court, is responsible for interpreting laws

7. The basketball court is divided into two halves, with each team playing offense and defense alternately.

8. The height of the basket and the court size varies depending on the age and skill level of the players.

9. The king's court is the official gathering place for his advisors and high-ranking officials.

10. The Lakers continue to be a dominant force in the NBA, with a dedicated fan base and a commitment to excellence on and off the court.

11. The Supreme Court is the highest court in the land and has the power of judicial review, meaning it can declare laws unconstitutional

Random Sentences

1. Pinapakain ng pulotgata ang mga langgam sa aming bakuran.

2. La película que vimos anoche fue una obra sublime del cine de autor.

3. Este año espero cosechar una buena cantidad de tomates de mi huerto.

4. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

5. Disente tignan ang kulay puti.

6. Musk has expressed interest in developing a brain-machine interface to help treat neurological conditions.

7. Mula sa pagiging simpleng atleta, si Hidilyn Diaz ay naging simbolo ng determinasyon at tagumpay.

8. God is a concept of a supreme being or divine force that is often worshiped and revered by religious communities.

9. Saan ka galing? bungad niya agad.

10. Les enseignants sont souvent formés dans des écoles de formation des enseignants.

11. Si Jose Rizal ay isang pambansang bayani ng Pilipinas na ipinanganak noong ika-19 ng Hunyo, 1861 sa Calamba, Laguna.

12. Ang droga ay isang mapanganib na sangkap na maaaring magdulot ng malubhang mga epekto sa kalusugan ng isang tao.

13. The Cybertruck, an upcoming electric pickup truck by Tesla, has garnered significant attention for its futuristic design and capabilities.

14. Sa pagtitipon ng mga lider ng kompanya, ibinahagi nila ang kanilang mga mungkahi upang mapaunlad ang negosyo.

15. Diyan ang bahay ni Mr. Marasigan.

16. Kings may have ceremonial duties, such as opening parliament or receiving foreign dignitaries.

17. Honesty is the best policy.

18. Si Sarah ay mahusay sa pagtugtog ng gitara, datapwat hindi siya marunong mag-awit.

19. Ang tubig-ulan ay maaaring magdulot ng kaguluhan sa mga lugar na hindi handa sa mga pagbabago sa panahon.

20. Naglalaway ako sa amoy ng niluluto mong adobo.

21. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

22. Ang mga salitang mapusok ng kundiman ay naglalarawan ng pagnanasa at pagsisigaw ng pusong umiibig.

23. Nang biglaang magdidilim ang paligid, nahirapan akong makita ang daan pauwi.

24. Ang mailap na kaligayahan ay kailangan hanapin ng mabuti.

25. Ang kanyang determinasyon ay nagliliyab habang nilalabanan ang mga pagsubok sa buhay.

26. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

27. Gusto niya ng magagandang tanawin.

28. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

29. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

30. Sop buntut adalah sup yang terbuat dari ekor sapi dengan rempah-rempah dan sayuran yang kaya rasa.

31. Magpupunta kami ng hospital mamaya upang magpa-checkup.

32. Tumaba sila ng tumaba hanggang sa tuwing maliligo kahit na pa tatlong tao lang sa sapa ay umaapaw agad tubig.

33. Narinig ng mga diyosa ang kayabangan ng bata.

34. Wag ka nang malumbay dahil nandito naman ako.

35. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

36. Mas matangkad ako kaysa sa kanya.

37. Dahil sa ugali ni Aya na hindi maganda, siya ngayon ay kinaiinisan ng mga taong dati ay sa kanya pumupuri.

38. The United States is a federal republic, meaning that power is divided between the national government and the individual states

39. Algunas plantas son comestibles y se utilizan en la alimentación, como las frutas y verduras.

40. La labradora de mi amigo es muy valiente y no le teme a nada.

41. Have we completed the project on time?

42. Lee's influence on the martial arts world is undeniable

43. The movie was absolutely captivating from beginning to end.

44. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

45. Internal Audit po. simpleng sagot ko.

46. Gusto mong pumasa sa pagsusulit? Kung gayon, dapat kang mag-review nang mabuti.

47. Nagpapasalamat ako sa aking mga magulang dahil sa kanilang bukas palad na pagtanggap sa akin kahit anong desisyon ko sa buhay.

48. Takot at kinakaliglig sa lamig ang Buto.

49. Ilang tao ang nagpapaitim sa beach?

50. Naglalambing ang aking anak.

Recent Searches

kaloobangcourtmaglalarotinangkamisteryohagdanannahintakutanipinadalatsemerchandisespecialwashingtonpamagatkinseikukumparanaglaropapalapitheartbeatsinusuklalyanmaibibigaymalagopayongdustpanmagsi-skiingnahantadmahiwagamakahiramsigurocallentrymaalogarteelenaheartmakapangyarihangfeltnangangalogminamasdanbigkumikilosnapasukokumulogjoshuanagkasunogdraft,diallednakikini-kinitaduwendepinagtagpopakistantiyakabundantenagtrabahogaanomagkasabaynagmamadalidiethumiwalaykalayuanabanganbinibilanghampasboksinglaloislandfraotrasnakakarinigbumababatoktumahimikfertilizernanghihinamadnagplaynakinigbagoexplainfaultworkshoplearnoutlineipinagbilingibonkasaganaanbutchnagpabakunagasolinainilistapagkapasokmagbantaynamumutlabumabahadisyembrehinugothumarapdispositivosisinakripisyoniyognandiyanbilihinbehindpunung-punohidingdontneverlikoduniversalganaincidencealambellgodnanooddreamkalikasaniligtasnagsinepasaheronatigilanbecameyaripagkagisingkingreplacedrevolucionadobilaorollnuclearpanoinfluencemalikotboyetlumulusobnapahintolimosallottedpakikipaglabannapakalusogreturnedngipingtelefonginagawapunongkahoybuhoksurgerymahawaannakilalanauntoghulubumuhospitosoonteacherdiagnosespagkainissinungalingpaglalayagbigongtenerpooktanyaghapasinkakayanangbusiness,karaokefitkinakasakitredesipinadumaanroofstockikinabitposporonangangaralphilippinelangkayexitorderinfederaldiscipliner,palakaconsistteknolohiyarememberpatakbowaiteripapainitratekalalarodisyemprecynthiakasalukuyanestablishikinamataysumigawpaparusahanmakaiponpssssteer