Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "pagkalito"

1. Tiyakan ang kanyang pagkakapagsalita; ibig niyang sa pagkalito ng bata sa pag-aapuhap ng isasagot ay masukol niyang buung-buo.

Random Sentences

1. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

2. Ang magnanakaw ay mahigpit na inabangan ng mga pulis matapos ang operasyon.

3. Lazada has a loyalty program called Lazada Wallet, which allows customers to earn cashback and discounts on purchases.

4. Después de la clase de yoga, me siento relajada y renovada.

5. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

6. Tinutulan ng komunidad ang anumang uri ng abuso laban sa mga kababaihan.

7. Einstein was a pacifist and advocated for world peace, speaking out against nuclear weapons and war.

8. Wedding planning can be a stressful but exciting time for the couple and their families.

9. Subalit kinabukasan, matapos isuga ang kalabaw ay bayawak naman ang napagtuunan ng pansin ng batang sutil.

10. They analyzed web traffic patterns to improve the site's user experience.

11. Kahit na lilipad ang isip ko'y torete sa'yo.

12.

13. Sa kasal, ang mga dalagang kasama ng bride ay nagdadala ng mga bulaklak at kumakanta.

14. Ang sarap kumain sa labas presko ang hangin.

15. Naging inspirasyon si Mabini para sa maraming Pilipino na maglingkod sa bayan.

16. There are a lot of reasons why I love living in this city.

17. Dahil sa determinasyon sa pag-aaral, si James ay naging valedictorian ng kanilang eskwelahan.

18. Ang ganda naman ng bago mong cellphone.

19. Erfaring har vist mig, at det er vigtigt at have en positiv tilgang til arbejdet.

20. Sa eroplano, hinde ko mapilitang hinde malungkot.

21. Kailangan nating magbasa araw-araw.

22. Tumango ako, you want? alok ko sa kanya.

23. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

24. Women make up roughly half of the world's population.

25. Can you please stop beating around the bush and just tell me what you really mean?

26. Ang tubig-ulan ay nagbibigay ng natural na tubig sa mga lawa at ilog, na nagbibigay ng tahanan at pagkain sa mga isda.

27. Paano umuuwi ng bahay si Katie?

28. Emphasis can be used to create a sense of drama or suspense.

29. Walang puno ang hindi hitik sa bunga.

30. Some oscilloscopes have built-in signal generators for testing and calibration purposes.

31. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

32. La alimentación equilibrada y una buena hidratación pueden favorecer la cicatrización de las heridas.

33. El invierno marca el final y el comienzo de un nuevo año, lleno de esperanzas y propósitos.

34. Cuando no sé qué hacer, simplemente confío en que "que sera, sera."

35. Nagkita kami kahapon sa restawran.

36. The Serengeti National Park in Tanzania is a natural wonder renowned for its wildlife and annual migration.

37. Medarbejdere skal overholde arbejdstider og deadlines.

38. Masaya at masaganang na naninirahan ang mga tao dito nagtutulungan at nagbibigayan din sila, kung tutusin perpekto ang bayang ito.

39.

40. He has been to Paris three times.

41. He returned to the United States in the late 1950s, and quickly established himself as a leading figure in the martial arts community

42. Bwisit ka sa buhay ko.

43. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

44. La salsa de habanero es muy picante, asegúrate de no agregar demasiado.

45. The impact of the pandemic on mental health has been immeasurable.

46. Sana, binigyan mo siya ng bulaklak.

47. Ang marahas na paggamit ng lakas ay labag sa etika at pagkamamamayan.

48. Naging tamad ito sa pag-aaral at sa mga gawaing bahay.

49. The LA Lakers, officially known as the Los Angeles Lakers, are a professional basketball team based in Los Angeles, California.

50. Actions speak louder than words.

Recent Searches

energy-coalpagkalitotangingnakatindigricakamiassanggolgalakdibisyonwalngbilinpangingimimaghilamosulamsusunduinsoretitigilmakipag-barkadatekstconcernsespadaputahemagsasalitakinahuhumalinganpalipat-lipatnagrereklamonagtatakbonapabayaanhospitalnapakatagalnagpakitanamulatuugod-ugodpambahaypagtinginmananakawaplicacionesnagtakanakakatandanagbantayromanticismokatuwaanhitanauliniganmumuntingmakikiligonasasalinanmananalonakasakitnalamandisfrutarhayaangmaulinigannecesariomakasalananglumamangarbejdsstyrkepagkainismahiyatindanapatulalalumayoafternoonsugatangcombatirlas,engkantadangmangahaspinangaralantog,itinulosgasmenhumihingilikodpantalongkargahandalawangabigaelvaledictorianadvancesallekapwamalawaksolarpatisang-ayoninihandapakilutoanimeranbigyanblusangasinpingganscientificrolandmakingcontestoverrestkakutisprimerasdecisionsstrengthmonumentointerestsclassesdifferentexpeditedcomputerskamalayanbunutandespuesteacherpagdamimatarayrememberedmaibibigayhatinggabiinirapanpropesorpagkaraaisinumpapagkaraanstyrermalamangsahiglittleumalishumpaypersonrodonashadesbagaygrabekalakimataastiyanlilikopinapakingganaanhinrevolutionizeddiba1950sahasestilospaki-chargepeteripapamanaikawcoaldiyanpotaenauniversitygabepakanta-kantapopulationdulamagpa-paskomagaling-galingeventoslibrocultivapinakabatangbagsakpaglalaitiintayinre-reviewfreedomsbarrerasannikapagkatdeletingiigibmedyomalaki-lakinasabingmasayahinhinigitmisabiggestlayasflexibleimpitbehalfdidnakatawagmalakinag-iimbitamanatilipagsasalitamarasigannagtungomaghihintaynaglutobiglaanpagiisipmasayamahirappayongnanigas