Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "households"

1. Television is a medium that has become a staple in most households around the world

Random Sentences

1. **You've got one text message**

2. Palaging sumunod sa mga alituntunin.

3. Si Ma'am Luisa ay magbabakasyon sa kanilang probinsya.

4. At have håb om, at tingene vil ordne sig, kan hjælpe os med at se lyset i slutningen af tunnelen.

5. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

6. Pumupunta siya sa Maynila bawat buwan.

7. Economic recessions and market crashes can have devastating effects on investors and the broader economy.

8. Seek feedback, it will help you to improve your manuscript

9. Tuwing Marso hanggang Hunyo ang summer break

10. Don't worry, it's just a storm in a teacup - it'll blow over soon.

11. Hindi ako sumang-ayon sa kanilang desisyon na ituloy ang proyekto.

12. El Día de San Valentín es una festividad muy popular en muchos países.

13. Bakit di mo 'to sinabi sa akin?

14. Les motivations peuvent changer au fil du temps, et il est important de s'adapter à ces changements pour rester motivé.

15. The authorities were stumped as to who the culprit could be in the unsolved case.

16. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

17. Green Lantern wields a power ring that allows him to create energy constructs based on his imagination.

18. Sa takip-silim, nagiging malamig ang panahon at nakakapagbigay ng komporta sa mga tao.

19. It was invented in England by the Scottish scientist J.N. Baird in 1928 and the British Broadcasting Corporation was the first to broadcast television images in 1929. Previously the radio helped us hear things from far and near.

20. Ramon, nanaisin ko pa na sila'y magbagong-anyo kaysa tuluyang mawala na sa atin.

21. Mahal na mahal ng ama't ina si Ranay.

22. Ang tamis ng pulotgata ay nagbibigay sa akin ng energy para magpatuloy sa araw.

23. Kucing juga dikenal sebagai pembasmi tikus dan serangga di rumah atau tempat tinggal.

24. Her lightweight suitcase allowed her to pack everything she needed for the weekend getaway without exceeding the airline's weight limit.

25. Last full show tayo. Ano bang pinakamalapit na mall?

26. She has been exercising every day for a month.

27. Jeg kan ikke skynde mig mere end jeg allerede gør. (I can't hurry more than I already am.)

28. Isa sa paborito kong kanta ng Bukas Palad ay "I Will Sing Forever".

29. Paglingon ko, nakita kong papalapit sakin si Lory.

30. I have received a promotion.

31. In the early days, telephones were connected to a central switchboard, which connected calls manually

32. Omelettes are a popular choice for those following a low-carb or high-protein diet.

33. Anong nangyari sa iyo? Bakit ang tagal mong nawala?

34. Marahil ay hindi pa sapat ang oras na nakalaan para matapos ang proyekto.

35. Lungkut na lungkot ang buto sapagkat madilim na madilim sa loob ng kasoy.

36. Me duele el estómago. (My stomach hurts.)

37. Para poder cosechar la uva a tiempo, debemos empezar con la vendimia en septiembre.

38. El nacimiento de un bebé es un momento de felicidad compartida con familiares y amigos.

39. Nilinis ng janitor ang silid-aralan bago mag-umpisa ang klase.

40. They organized a marathon, with all proceeds going to charitable causes.

41. Sumigaw siya ng "sandali lang!" ngunit patuloy itong naglakad palayo.

42. Ang mga tao na gumagamit ng droga ay maaaring tumanggap ng tulong sa mga rehab center upang magbago ang kanilang buhay.

43. May I know your name for our records?

44. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

45. Nationalism has been a powerful force in shaping the modern world, particularly in the aftermath of colonialism.

46. Nag-ugat sa puso ni Durian na mahalin ang sakop ng kanyang ama.

47. She has lost 10 pounds.

48. Amazon started as an online bookstore, but it has since expanded into other areas.

49. Nang malapit na siya, nagtatakbo ang dalaga at nawalang parang bula.

50. Binibigyan niya ng halaga ang bawat oras na pinagsisikapan niya upang maging mabuting ina.

Recent Searches

householdspinaghatidannakasahodsipapinahalatamalalakiumikotipinauutangnakaakyatpaidmaghaponnasagutantaxibutikieksempelprimerasvisualdahan-dahanlumipashapag-kainanrebopunohiningakumidlatkinakitaannakikini-kinitalilykindergartenkassingulangrespektivehumihingifulfillmentkapatagannasilawdiferentestawanakakagalasaletumawagmagpaniwalanag-iinomyamannagmakaawamarketplacespatungonangapatdanmaghahabimarasiganfallumagawmagbibiladkomedorkalakijennyworldenglishpulanglumitawtumayonangagsipagkantahanseenpampagandabibilhinahhhhampliasapotabigaelinspirevegashinintaykulisapherramientasinastamanalonapadaande-latapesosallenandunpinilitagilapigingthankkasakitasiaticinimbitaganapinsacrificetibigmissionkulotasimtatanghaliinaaisshpakilutopakakatandaanlookedbigyanlaybrariiyanfrescodisposallenguajekinantaclockdunkansermagsi-skiingmaliwanagpagkainisderallottedibigsaidnagpuntameaningpulubifonossolarasojobskankinaintrabahomuchosbataysinipangstilleffortsgisingsabihingmoderninaasahandettepinyaarawunderholdergasmenfiverrnamingmatanguncheckedofficekayoaalismaaariboyetboksingtryghedcryptocurrencytandaworrypalagingbinabaanjeromepossibleearlyumiinitcigarettesusedtinitindadyipbumuhosmereannastoplightbroadgrabecomunesaddressperabasasmokingmakapaniwalabeginningsnakatulogturismo1973generatedableinformedbetweenmonitorfirstamazonconditionipinalutoemocionesligamabuhayshortutakbulaburmakainisgagambaunattendednagdarasalumulannagsmile