Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "presence,"

1. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

2. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

3. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

4. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

5. He was known for his active and controversial presence on social media, particularly Twitter.

6. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

7. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

8. Tesla has expanded its operations globally, with presence in various countries and plans for further expansion.

9. The company's acquisition of new assets will help it expand its global presence.

10. The Lakers have a strong philanthropic presence in the community, supporting various charitable initiatives and organizations.

11. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

12. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

13. Yumabong ang mga negosyo na mayroong social media presence dahil sa kanilang pagkakaroon ng mas malawak na market.

Random Sentences

1. Sa mga lugar na madalas tamaan ng buhawi, ang mga pamahalaan at mga organisasyon ay kailangang magkaroon ng mga programa para sa risk reduction at disaster preparedness.

2. Sa mga lugar na malapit sa ilog, ang mga punong-kahoy ay nakakatulong sa pagpapabuti ng kalidad ng tubig.

3. He has visited his grandparents twice this year.

4. Det er vigtigt at have en kompetent og erfaren jordemoder eller læge til stede under fødslen.

5. Nasa kumbento si Father Oscar.

6. The doctor advised him to get plenty of rest and fluids to recover from pneumonia.

7. Psss. napatignin ako kay Maico. Naka-smirk siya.

8. Nakakatulong ang paghinga ng malalim at pagsisimula ng halinghing para sa relaxation.

9. Football is played with two teams of 11 players each, including one goalkeeper.

10. Sa bawat pagkakamali, mayroong aral na pwedeng matutunan, datapapwat ay masakit ang mawalan ng pagkakataon.

11. Buwenas si Fe sa kanyang negosyo.

12. Videnskab er systematisk undersøgelse af natur og universet ved hjælp af metoder som observation, eksperimentering og analyse

13. May natagpuan umanong bagong ebidensya sa kaso ng pagkawala ng bata.

14. Sa buwan ng Mayo ang kaarawan ko.

15. Tantangan hidup adalah kesempatan untuk belajar, tumbuh, dan mengembangkan ketahanan diri.

16. The Serengeti National Park in Tanzania is a natural wonder renowned for its wildlife and annual migration.

17. Muli niyang itinaas ang kamay.

18. Hindi minabuti ni Ogor ang kanyang pagsigaw.

19. Magkano ang arkila kung isang linggo?

20. Lazada has a strong focus on customer service and has won awards for its efforts.

21. Les outils de reconnaissance faciale utilisent l'intelligence artificielle pour identifier les individus dans les images.

22. The king's subjects are the people who live in his kingdom and are under his rule.

23. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

24. Kailangan ng mas malawak at mas matatag na suporta sa sektor ng anak-pawis upang malutas ang mga isyu ng kahirapan.

25. Elvis Presley, also known as the King of Rock and Roll, was a legendary musician, singer, and actor who rose to fame in the 1950s

26. Wala kang dalang payong? Kung gayon, mababasa ka ng ulan.

27. Recycling and reducing waste are important ways to protect the environment and conserve resources.

28. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

29. Pinagsabihan siya ng guro dahil napansin ang kanyang pagiging maramot sa mga kaklase.

30. Bakit sila makikikain sa bahay niya?

31. La paciencia es necesaria para superar las pruebas de la vida.

32. John Adams, the second president of the United States, served from 1797 to 1801.

33. Peer-to-peer lending: You can lend money to individuals or small businesses through online platforms like Lending Club or Prosper

34. Malamig na pawis ang gumigiti sa kanyang noo at ang tuhod niya ay parang nangangalog.

35. Maraming mga bata ang mahilig sa pagguhit dahil ito ay isang paraan upang magpakita ng kanilang imahinasyon.

36. He is having a conversation with his friend.

37. Anong kulay ang gusto ni Merlinda?

38. Ahhhh ok. Ilan ba ang kapatid mo? tanong ko.

39. Ang nakapagngangalit, unti-unti na namang nalalagas ang kaniyang buhok.

40. Libreng nakakakuha ng atensyong medikal ang lugar nila Alfred.

41. Drømme kan være en kilde til kreativitet og innovation.

42. Doa juga bisa dianggap sebagai bentuk ungkapan syukur atas nikmat dan karunia yang diberikan Tuhan.

43. Kailangang pag-isipan natin ang programa.

44. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

45. Wala ka naman sa kabilang kwarto eh.

46. Sa ganang iyo, mahalaga ba talaga ang pagkakaroon ng mataas na grado sa eskwelahan?

47. Mukhang masarap ang prutas ngunit wala sino man ang mangahas na kumain nito sapagkat ang mga bunga ay lason.

48. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

49. Ano ang ginugunita sa Thanksgiving Day?

50. Ada udang di balik batu.

Recent Searches

namumutlapresence,growthnanalomanatilipambatangnagbentamangnakabibingingmakapalctricasnewsbenefitsmaglabamahigpittulongphilosophicalalmacenarheartbeatnaglulutountimelytelefonadditionally,lookedpataybumigaydirectabalances1954goaltasausepatpatfull-timegabingbisigsuccesssorrybroadcastbotetransparentcongratsmaminakitafindballsumalanapakobubongscheduletrackcablestringallowedappmagagawadumagundongkwenta-kwentat-shirtnakagalawmagtatagalpresidenteinasikasoyumabongnapakagandaipinatawagarbejdsstyrketahimikpaanai-dialpeksmanfactoresdamdamintagpiangcruznagdalaumimikkumulogpasasalamatnalungkotmagbabalaalagangbathalalilikobarrerassakop3hrsgloriaydelsertengamariecareerhelpedcolormabaitnatulogangkanganangboholnabiawangsinagotmakisigcasasayoverallbinibinibabesbatayissuesfinishedeeeehhhhimaginationimpitcandidatepressabssettingnapilingconvertingreleasedkanilapunong-kahoybroadhubad-baroagam-agamkadalagahangpagkalitokaano-anodahan-dahanbestfrienddigitalhayo-onlinepinapataposnareklamoheartbreaknapakalusogjingjingkanginabalediktoryanpasaherokristonapahintoeksempelbakantebefolkningenkaraokebulalasnanigasmatutulogvictoriabusiness:hanapinitinulossarongmatandangilihimkinalimutanlakadmanalopinilitmbaloiskedyulsacrificeanitofederalbankyarilumulusobupokahitagosaudio-visuallyerapspentbilerpetsalabingfeelmaputicorrectingpaslitnanghahapdinamumulaklakmagsalitakategori,pupuntadatapwatnakasahodpanghihiyangtinaasanclubnapakagandangnagtagisantaksitaun-taoniintayinmasayahinmag-aaralliv,