Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "presence,"

1. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

2. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

3. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

4. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

5. He was known for his active and controversial presence on social media, particularly Twitter.

6. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

7. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

8. Tesla has expanded its operations globally, with presence in various countries and plans for further expansion.

9. The company's acquisition of new assets will help it expand its global presence.

10. The Lakers have a strong philanthropic presence in the community, supporting various charitable initiatives and organizations.

11. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

12. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

13. Yumabong ang mga negosyo na mayroong social media presence dahil sa kanilang pagkakaroon ng mas malawak na market.

Random Sentences

1. Ibinigay niya ang kanyang pagmamahal at pag-aalaga upang masiguro ang kaginhawahan ng kanyang pamilya.

2. Maaaring magbago ang ekonomiya ng isang bansa dahil sa digmaan.

3. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

4. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

5. Las labradoras son muy leales y pueden ser grandes compañeros de vida.

6. Today, Presley is widely considered to be one of the most important figures in American music and culture

7. Nakita niya ata ako kaya tinigil niya yung pagsasalita niya.

8. Smoking is prohibited in many public places and workplaces to protect non-smokers from secondhand smoke exposure.

9. Sa aming mga paglalakbay, nakakita kami ng mga kapatagan na mayabong na mga pastulan.

10. Når man bliver kvinde, åbner der sig mange nye muligheder og udfordringer.

11. May pista sa susunod na linggo.

12. Good morning. tapos nag smile ako

13. Matagal ko nang nararamdaman ang mga ito, kaya sana pwede ba kita ligawan?

14. Sa bawat tula ng makata, maririnig ang malalim na hinagpis ng kanyang puso.

15. Ang droga ay isang mapanganib na sangkap na maaaring magdulot ng malubhang mga epekto sa kalusugan ng isang tao.

16. Russell Westbrook is known for his explosive athleticism and ability to record triple-doubles.

17. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

18. Ano ang ginagawa ni Trina tuwing Mayo?

19. Det er vigtigt at have en positiv indstilling og tro på sig selv, når man bliver kvinde.

20. Natapakan ako ni Juliet habang sumasayaw.

21. Durante las vacaciones de otoño, visitamos viñedos para la vendimia.

22. Ang pagtulog ng maayos ay nagpapabuti sa emosyonal na kalusugan at nagbibigay ng katahimikan at kapanatagan sa puso't isipan.

23. Los héroes son capaces de tomar decisiones difíciles y hacer sacrificios personales en beneficio de los demás.

24. At være transkønnet kan være en svær og udfordrende rejse, da det kræver en dyb forståelse af ens identitet og en følelse af mod og autenticitet.

25. Hindi ko alam kung bakit hindi ka pa rin nakakapag-move on sa kahit anong nangyari.

26. Tinaas ko yung isang kilay ko, I'm working for him noh.

27. Durante el invierno, se pueden ver las auroras boreales en algunas partes del mundo.

28. Hindi maiiwasang magkaroon ng mga biktima sa digmaan, kasama na ang mga sibilyan.

29. As the eggs cook, they are gently folded and flipped to create a folded or rolled shape.

30. Nakinig ang mga estudyante sa guro.

31. Ang mga magsasaka ay nagtatanim ng mais para sa kanilang kabuhayan.

32. Busog pa ako, kakatapos ko lang mag merienda.

33. Sa halip na umalis ay lalong lumapit ang bata.

34. The invention of the telephone led to the creation of the first radio dramas and comedies

35. Hindi ko naiintindihan kung ano ang magiging resulta ng kanilang plano kaya ako ay tumututol.

36. Malaya na si Jerry matapos itong makulong ng limang taon.

37. May gusto lang akong malaman.. I have to ask him.

38. Nationalism can inspire a sense of pride and patriotism in one's country.

39. Mahilig akong kumanta ng mga awiting gawa ng Bukas Palad.

40. Sa harapan niya piniling magdaan.

41. Naglipana ang mga ibon sa hardin ngayong tag-araw.

42. Si Mang Ernan naman na isang manunulat, isa ring propesor sa isang unibersidad sa maynilaat nagging kasapirin sa iba't ibang samahan

43. Si Rizal ay isang maalam na mag-aaral na nag-aral sa Unibersidad ng Santo Tomas, Unibersidad ng Madrid, at Unibersidad ng Heidelberg.

44. Sang-ayon ako na kailangan nating magtulungan upang malutas ang mga suliranin ng ating lipunan.

45. They must maintain transparency and communicate with their constituents to build trust and ensure representation is effective.

46. Pneumonia is a serious infection that affects the lungs.

47.

48. Ang paggamit ng droga ay maaaring magdulot ng mga epekto sa kalusugan ng sanggol kung ang isang buntis na babae ay gumagamit ng droga.

49. Modern civilization is based upon the use of machines

50. Les encouragements et les récompenses peuvent être utilisés pour motiver les autres, mais il est important de ne pas les rendre dépendants de ces stimuli.

Recent Searches

kapasyahanpresence,insektonginilalabasnakuhangkatawangnatitiyakpedesabognaapektuhanmahinogmahahalikfitnesskanangnapasigawleksiyonfuncionarblazingpinagkaloobankapintasangnamumulabutikitahanankatutubona-fundsamantalangsisikattulisankulturpinauwiiiwasanpakistandecreasedtandanglibertylever,siyudadbasahinaustralianagplaywakasnagwikangisinalaysayhawladiagnosticmadalingdiseasespagpasokcampaignsnakabiladsakaytagalogangkanboholgaggabrielmaibalikuntimelymatapangkabuhayansumingittigaspatiencetenderabonoestablishscientificparagraphsipanlinismakalaglag-pantypilingmasakithalalancosechasbroadcastcongresssenatebatokabrilmaestrolupakabosesingatankatandaan1920ssemillasbinasamakapasafridaylatestpingganhamakpitakabatipresyonabalotpamangkinnagtaaspageantmagta-taxikailanganbusactingcommunicationdrayberdragonfigurescrosspreviouslydownaddimaginginterestteambumabaresultanapilingnagdaraanrelievedfrogcomputeremonetizingsofanothingkaibadevelopngaerrors,programsclockpinag-aralanmessagetwokastilamatutongmumuntingpaalamharapancoursesmagagamitsongslugarpalitanlabinsiyambiyernesdalawindalagangmagmulabingbingsiyaperobio-gas-developingsagotgrewkilalang-kilalapalayokuniquemais1980fulfillmentnaninirahanmemoryoffentligeitinalagangwatchsumusulaturibeinteaffectsourcebahagyangpromisealanganincitamenterkuliglignagbibigayancramebobumiwasmadebaku-bakongmumuraikinamataynagulatikinabubuhaymanamis-namisnagtutulunganmagkahawaknagtatanongmaabutannakabluemaghaponinuulamtinataluntonumagawdeliciosahubad-baromanghikayatfilmnakapagsabi