Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "presence,"

1. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

2. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

3. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

4. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

5. He was known for his active and controversial presence on social media, particularly Twitter.

6. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

7. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

8. Tesla has expanded its operations globally, with presence in various countries and plans for further expansion.

9. The company's acquisition of new assets will help it expand its global presence.

10. The Lakers have a strong philanthropic presence in the community, supporting various charitable initiatives and organizations.

11. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

12. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

13. Yumabong ang mga negosyo na mayroong social media presence dahil sa kanilang pagkakaroon ng mas malawak na market.

Random Sentences

1. A dedicated employee goes above and beyond their job requirements to contribute to the success of their organization.

2. Bawal kang mapagod.. papagalitan nila ako pag napagod ka..

3. J'ai acheté un nouveau sac à main aujourd'hui.

4. ¡Buenas noches!

5. Napakabilis talaga ng panahon.

6. The concert last night was absolutely amazing.

7. Upang magawa ito, pinag-aralan niyang makapagsalita ng kanilang wika.

8. Mayroon pa ho sana akong gustong itanong.

9. En invierno, las personas disfrutan de bebidas calientes como el chocolate caliente y el té.

10. Gusto mong makatipid? Kung gayon, iwasan mong gumastos sa mga di-kailangang bagay.

11. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

12. The height of the basket and the court size varies depending on the age and skill level of the players.

13. Ang pagbibigay ng ampao ay isang tradisyonal na paraan ng pagpapakita ng paggalang sa matatanda sa Chinese New Year.

14. Naghahanap ako ng mapa ng bansa para sa aking proyektong pang-geography.

15. Masayang kasayaw ng mga Kuneho ang mga Usa, ng mga Elepante ang mga Tamaraw, ng Zebra ang Tsonggo.

16. "Ang hindi magmahal sa sariling wika, daig pa ang malansang isda" ay isang bukambibig na nagpapahayag ng pagpapahalaga sa ating sariling wika at kultura.

17. Limitations can be cultural or societal, such as gender roles or stereotypes.

18. Ang pangalan ni Rizal ay itinuturing na sagisag ng pambansang identidad at paglaya sa Pilipinas.

19. Mahirap magsalita nang diretsahan, pero sana pwede ba kitang mahalin?

20. Si Tom ay nag-aapuhap ng paumanhin sa kanyang mga kaibigan matapos ang kanilang pag-aaway.

21. Los padres experimentan una mezcla de emociones durante el nacimiento de su hijo.

22. Napadami ang inom ni Berto kaya't ito ay nalasing.

23. El cultivo de arroz requiere de un terreno inundado y condiciones climáticas específicas.

24. Nagsisilbi siya bilang abogado upang itaguyod ang katarungan sa kanyang kliyente.

25. Ano ang inireseta ng doktor mo sa iyo?

26. Matutulog ako mamayang alas-dose.

27. Las personas pobres a menudo carecen de recursos para protegerse de desastres naturales y crisis.

28. Sa mga kasal, kadalasan ay mayroong programa ng sayawan upang mas masaya ang pagdiriwang.

29. Ailments can range from minor issues like a headache to serious conditions like cancer.

30. Kucing di Indonesia sering dijadikan sebagai hewan peliharaan yang cocok untuk apartemen atau rumah kecil.

31. Les écoles travaillent à fournir un environnement d'apprentissage sûr et inclusif pour tous les étudiants.

32. Scissors are a cutting tool with two blades joined together at a pivot point.

33. Durante las vacaciones, disfruto de largos paseos por la naturaleza.

34. I love you so much.

35. Pagdating namin dun eh walang tao.

36. La música es un lenguaje universal que trasciende las barreras del idioma y la cultura

37. Limitations can be a result of geographic location or access to resources and opportunities.

38. Mahilig sya manood ng mga tutorials sa youtube.

39. Many people go to Boracay in the summer.

40. Hindi niya napigilan ang pagdila sa kanyang labi nang naglalaway siya sa pagkaing inihain sa kanya.

41. Isang maliit na kubo ang nakatayo sa itaas ng baranggay, sa tagiliran mismo ng bundok na balot ng makapal na gubat.

42. A lot of traffic on the highway delayed our trip.

43. No te preocupes, estaré bien, cuídate mucho y disfruta de tus vacaciones.

44. They have organized a charity event.

45. Las heridas infectadas pueden requerir de antibióticos para su tratamiento.

46. Das Gewissen ist unsere innere Stimme, die uns sagt, was richtig und falsch ist.

47. Si Doming na nagkaroon ng kasintahan na maganda ay inagaw ng kanyang kaibigan

48. El mal comportamiento en clase está llamando la atención del profesor.

49. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

50. Jouer de manière responsable et contrôler ses habitudes de jeu est crucial pour éviter des conséquences graves.

Recent Searches

presence,pagluluksagumagalaw-galawsalitangnagtutulungankamiasrelo1980kelanbagamatbilhinexpeditedsumakitnangampanyamangingisdangmanagerinimbitaakmapantalongsaktanlastinggymnakakainmatakawpopcornnawawalaexhaustedoverclassesrestideamanakbopracticadochessmalakasasthmanaglokohanmulsoundnag-isipbanalamintransportattorneyminahannagbungamatapobrengpedemasaholsumalimanoodtotoonghitiktagtuyotreahhappenedgalawmuchoskaparehapropensosambiteasierroboticmaayosexistgoingnabalitaanvictoriatransport,ricapagtataasniyanbarcelonanakapagngangalitenerolockedsiopao1982paumanhinkagipitanhomenapilikalongkargahanligalignagtatakadawlabanislaquezonchoosenilapitanmaasahangrinskahusayannapahintonaglabastudentiyowatawatmalezamamalasmaraminearsofamissionhinimas-himashalikaalagangotraskommunikererenhedermag-usapyakapinnakakatandananinirahansumasaliwlaryngitisvivapagkakatuwaantirahanpasyentehinagiscompartenipagamotuwakpulamanghulilumipadmanilapatunayanpakikipagtagpofaktorer,actualidadatensyonbakantekarangalannauliniganrolenapakahangagobernadornagreplynapapatinginminutonaguguluhannamumutlarevolutioneretkasalkisapmatadarknanoodbrucemukaincomemunaviewskristonilulontokyotaasnaisisusuotsawsawanikinalulungkotnababakassumapitnakaka-inpisngihitanag-oorasyonmadesahigpalaynatitiyakwowsarilikunenapatakbobahagyamaglarojuliusmalapadikinatatakotbestnyeunangpamasahekaarawannakinigmauntogkalakihanipanlinislakadinterviewingoutlinesasapakinrequierenkayoilanisinawak