Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "presence,"

1. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

2. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

3. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

4. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

5. He was known for his active and controversial presence on social media, particularly Twitter.

6. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

7. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

8. Tesla has expanded its operations globally, with presence in various countries and plans for further expansion.

9. The company's acquisition of new assets will help it expand its global presence.

10. The Lakers have a strong philanthropic presence in the community, supporting various charitable initiatives and organizations.

11. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

12. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

13. Yumabong ang mga negosyo na mayroong social media presence dahil sa kanilang pagkakaroon ng mas malawak na market.

Random Sentences

1. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

2. Frustration can also be caused by interpersonal conflicts or misunderstandings.

3. He is not painting a picture today.

4. Saan ka kumuha ng ipinamili mo niyan, Nanay?

5. We have been painting the room for hours.

6. The Little Mermaid falls in love with a prince and makes a deal with a sea witch to become human.

7. At have en træningsmakker eller træningsgruppe kan hjælpe med at øge motivationen og fastholde en regelmæssig træningsrutine.

8. The meeting was cancelled, and therefore he had the afternoon off.

9. Las hojas de afeitar deben cambiarse con frecuencia para evitar irritaciones en la piel.

10. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

11. Les hôpitaux peuvent être des environnements stériles pour prévenir la propagation des infections.

12. Nagtagal ang sakit ni Aling Rosa kaya't napilitang si Pinang ang gumagawa sa bahay.

13. I have received a promotion.

14. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

15. Nangahas ang manunulat na talakayin ang kontrobersyal na isyu sa kanyang aklat.

16. Binasa niya ang balikat, ang mga bisig.

17. Ang mga bayani ay nagpapakita ng matapang na paglaban laban sa pang-aapi at kawalang-katarungan.

18. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

19. Hindi ka ba papasok? tanong niya.

20. La boda de mi amigo fue una celebración inolvidable.

21. Aray! nagcurve ball sya sa sakit sa sahig.

22. Ilang oras silang nagmartsa?

23. Ang karagatan ay malalim at malawak na lugar na puno ng buhay-alon.

24. Hindi maganda na supilin ang kalayaan ng mga mamamahayag sa bansa.

25. La novela de Gabriel García Márquez es un ejemplo sublime del realismo mágico.

26. Dedication is the commitment and perseverance towards achieving a goal or purpose.

27. 11pm na. Pinatay ko na ilaw sa hospital room ni Cross.

28. Sa ganang iyo, may katuturan ba ang kanyang paliwanag sa harap ng hukom?

29. Women have been elected to political office in increasing numbers in recent years, though still underrepresented in many countries.

30. Electric cars are environmentally friendly as they emit no tailpipe pollutants and produce zero greenhouse gas emissions.

31. Hawak nito ang isang maliit na bangos na tig-bebente, sa loob-loob ni Aling Marta.

32. Ang kanyang negosyo ay lumago nang husto, samakatuwid, nakapagbukas siya ng panibagong branch.

33. I am absolutely grateful for all the support I received.

34. En god samvittighed kan være en kilde til personlig styrke og selvtillid.

35. Un powerbank completamente cargado puede ser una fuente de energía de respaldo en caso de emergencia.

36. They have already finished their dinner.

37. Bagamat naghihirap ay alaga siya ng ama't ina sa masasarap na pagkain.

38. Ina, huwag mo po kaming iwan! ang iyak ni Maria.

39. ¿Cómo has estado?

40. Pendidikan agama merupakan bagian integral dalam kurikulum pendidikan di Indonesia, memungkinkan generasi muda untuk memahami dan menghargai agama-agama yang berbeda.

41. Pinaniniwalaang ang albularyo ay may kaalaman sa lihim na karunungan ng kagubatan.

42. He has fixed the computer.

43. The Jungle Book introduces Mowgli, a young boy raised by wolves, as he encounters various jungle animals and learns life lessons.

44. Los héroes nos inspiran a ser mejores y nos muestran el poder de la bondad y el sacrificio.

45. Hindi ka ba napaplastikan sa sarili mo, tol?

46. Si Mary ay masipag mag-aral.

47. Det danske økonomisystem er kendt for sin høje grad af velstand og velfærd

48. Mabini Hall ang tawag sa gusali kung saan nagsisimula ang mga klase sa Polytechnic University of the Philippines.

49. Napatakbo ako sa kinalalagyan ng landline ng tumunog yun.

50. Bumuhos ang pawis niya sa sobrang gutom at naglalaway na siya.

Recent Searches

pronounpalaisipanpresence,gagawiniintayinunahinbalitasasabihinflyvemaskinernagsisipag-uwianpinagmamalakiginugunitanagpapaigibnakaluhodkayang-kayanghawaiimaipapautangarbularyokulunganpaghalikskyldes,investjuegosmahiwagastep-by-stepmasasamang-loobpahabolmasyadongre-reviewlumabaspamagatisinagotmasasabinakakaanimcompaniesintensidadkailanmananumangkarapatangpapalapitmasaganangpaulit-ulithagdananbayadculturesnglalabamartianarturogroceryumokayhalinglinglalotagumpayendviderebintanatalaganglupainandoynapilitangkanilaengkantadabunutanpagpasoktagakhinintaylumalakilabasemailclassmatefe-facebookinvitationmagsasakawaitermaalwangdiseasetenerpinalayassapotmasakitkasoyfionauniquecelularesandreassociationalitaptapbituinahitbasarelievedmagkasinggandahugisiniinomsuotiniangatdelepanaymabaitbateryapaskongkarangalanmaranasanhinogventanakikilalanginitkaloobangcoachingsakimhumalosabogsisidlansimplenghearbitbitamparotoretecupidspentabalaaywankakayananredessummitpaglisanprovidemulaataquesisugalargerespadalulusogparatingincreasedmuchfacebroadworkdayfeelinglockdownresultrelativelytypesplasmachangememorialfysik,nakakagalingbusyangofficenewstsssbalingalekabighacomunicarsecuandorangegamespwestomakasarilingpackagingdahilevolvedkolehiyoadaptabilitydumaraminutscommunicatemakesdividesabledingdingsolidifydebatesmagtataasdamitdiwatacommissionstillsamakatuwidkahitmagandastorsharmainenatinkalayaanyonganilabutilyoutube,libanganiligtaspsssmaghapongkeepingpaki-basapulaandresrabba