Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "artistas"

1. Algunos artistas famosos incluyen a Leonardo da Vinci, Pablo Picasso y Frida Kahlo.

2. Miguel Ángel es considerado uno de los artistas más influyentes de la historia del arte occidental.

3. Muchas ciudades tienen museos de arte que exhiben obras de artistas locales e internacionales.

4. Uno de los festivales de música más importantes de España es el Festival de San Sebastián, que se celebra en septiembre y cuenta con la participación de artistas de renombre internacional

Random Sentences

1. Halos nakalimutan na ng mag-asawa ang nangyari sa diwata.

2. Je suis en train de faire la vaisselle.

3. Limitations can be challenging, but they can also inspire creativity and innovation.

4. Tinulungan ko siyang dalhin yung mga plato sa dining room.

5. Sweet foods are often associated with desserts, such as cakes and pastries.

6. Quiero tener éxito en mi carrera y alcanzar mis metas profesionales. (I want to succeed in my career and achieve my professional goals.)

7. Det er vigtigt at skabe en inkluderende og støttende samfund for transkønnede personer og bekæmpe diskrimination og intolerance.

8. The cake is still warm from the oven.

9. Natutuwa ako kapag nakakakita ako ng isang halamanang mayabong sa mga pampublikong lugar.

10. Maraming Pinoy ang magaling sa pagluluto ng mga lutong bahay.

11. Hindi ka man makahanap ng kasama, mayroon kang kaulayaw sa loob ng puso mo.

12. Ate Annika naman eh, gusto ko ng toy!

13. Las redes sociales pueden ser una fuente importante de noticias y eventos actuales.

14. Ang aming angkan ay mayroong mga natatanging tula at awitin.

15. Muli ay nakabawi ang ekonomiya ng Pilipinas matapos buksan ang turismo sa iba't ibang panig ng bansa.

16. Ngunit kailangang lumakad na siya.

17. Ano ang gagawin mo sa Linggo?

18. Arbejdsgivere kan fremme mangfoldighed og inklusion på arbejdspladsen for at skabe en retfærdig arbejdsmiljø for alle.

19. The website is currently down for maintenance, but it will be back up soon.

20. Ayaw siyang pagawain sa bahay at sustentado siyang mabuti sa pagkain.

21. Presley's influence on American culture is undeniable

22. Eksport af forskning og udvikling er en vigtig del af den danske økonomi.

23. Hindi ko ho makain dahil napakaalat.

24. The stuntman performed a risky jump from one building to another.

25. Hindi maunawaan ni Bereti ngunit eksayted siya sa buhay nina Karing.

26. Many fathers have to balance work responsibilities with family obligations, which can be challenging but rewarding.

27. Sinabi ko nang binangga ako nang pasadya, na naramdaman ko ang kanyang kamay sa aking bulsa.

28. El estudiante con el peinado raro está llamando la atención de sus compañeros.

29. I am not reading a book at this time.

30. Nahuli ang salarin habang nagtatago sa isang abandonadong bahay.

31. Ito ang barangay na pinamumunuan ni Datu Diliwariw.

32. The Northern Lights, also known as Aurora Borealis, are a natural wonder of the world.

33. Some people find fulfillment in volunteer or unpaid work outside of their regular jobs.

34. Oscilloscopes display voltage as a function of time on a graphical screen.

35. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

36. Ako ay bumili ng lapis sa tindahan

37. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

38. Foreclosed properties can be a good option for those who are looking for a fixer-upper project.

39. This has led to increased trade and commerce, as well as greater mobility for individuals

40. There were a lot of boxes to unpack after the move.

41. Los trabajadores agrícolas se encargan de cosechar los campos a mano.

42. Lumaganap ang panaghoy ng mga magsasaka dahil sa kakulangan ng tubig para sa kanilang pananim.

43. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

44. Siya nama'y maglalabing-anim na.

45. Heto ho ang isang daang piso.

46. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

47. Working in a supportive and positive environment can improve job satisfaction.

48. Les hôpitaux peuvent être surchargés en période de crise sanitaire.

49. Gusto kong bumili ng bagong cellphone, datapwat ang aking kasalukuyang cellphone ay gumagana pa naman.

50. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

Recent Searches

kuwadernokapangyarihangeducativasturismoartistasfriendscountryadvertising,ganyansundhedspleje,namulatsuwailhandaanlegendsmakalaglag-pantybabasahinbuwenassaanmamahalinnakakapasokopisinatoonakahigangmagalangnearkaramihannatitiramasasalubongnagpepekecanteenkommunikererpromoteconsumenalamannakatagopinagtinikgreatnamataybumalikmatangumpaypagsahoddistansyapeppysahignasasalinanbumaligtadpamanunahinbahagyangnakaakyatsiopaonakakatandabumitawnagpaalamnapakasinungalingkalalarohinatidorkidyasputitsakakahirapanangkingperotimestanduwakipinalitbinilhancomunicarseschoolsbilisshortumigtadmagpagupitpauwimakulitkassingulangnaglakadbinilisuccessfuljuliusataqueshurtigereberetilimosincreasedmaaringnapapasayasandwichalakgapgatheringelectresignationanimoyumiyaksaraposterdissediagnosesnaabotkailannangyariaksidentemaramotparangatensyongcontestlutuinpagkakayakapprogressmrskumukulolumakilasingexistumikotshiftlangitbeyondmanonoodnatatapospigingmakalingtapebreaklumutangkumainkakataposrebolusyonfistskaininoutrumaragasangcantv-showsbihasamulighedisipninyokaibiganayawsamantalangbihirangtelatuladpagkatipinagbabawalluispagsagottaksipalayansangapagsambadaladalaubomayconstitutionnaiskasoypanalanginparusagawingustomalungkotnapagodkamalayanemocionaliniangatpublishing,spentibilipopcornkisapmatasiglospiritualmagkakaanakluboskahitstockstanyagmanakboautomationsourceguardamaghahabirodonajailhousepasiyentepagkaraafertilizertamastringstorymagpagalingconclusion,pilipinohanggangginagawa