Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "maliksi"

1. Maliksi siyang lumapit at binatak ang bata sa liig.

Random Sentences

1. Naghahanap ako ng mga chord ng kanta ng Bukas Palad sa internet.

2. Hindi minabuti ni Ogor ang kanyang pagsigaw.

3. Siya ang nagpatuloy sa pag-aagwador.

4. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

5. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

6. She has excellent credit and is eligible for a low-interest loan.

7. Ikinagagalak naming anyayahan kayo sa aming kasal.

8. Eksport af tøj og beklædningsgenstande fra Danmark er også stigende.

9. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

10. Las plantas ornamentales se cultivan por su belleza y se utilizan para decorar jardines y espacios interiores.

11. The elephant in the room is that the company is losing money, and we need to come up with a solution.

12. Bibisita ako sa lola ko sa Mayo.

13. Andre helte arbejder hver dag for at gøre en forskel på en mere stille måde.

14. The company acquired assets worth millions of dollars last year.

15. Helte kan være en kilde til inspiration og motivation.

16. The two most common types of coffee beans are Arabica and Robusta.

17. Bawal maglaro ng bola sa loob ng bahay dahil ito ay nakakasira ng gamit.

18. Sayur asem adalah sup sayuran dengan bumbu yang asam dan pedas.

19. Dahil malilimutin ako, nakalimutan ko na naman ang pangalan ng bagong kaklase.

20. Ang guro ko sa Panitikan ay nagturo sa amin ng mga panitikan mula sa iba't ibang panahon.

21. The culprit who stole the purse was caught on camera and identified by the victim.

22. Nag-aalalang sambit ng matanda.

23. Papasa ka kung mag-aaral ka ng leksiyon mo.

24. Kailangan mong bumili ng gamot.

25. Nagtitinda ang tindera ng prutas.

26. Pinagsisihan niya ang mga salitang hinugot niya mula sa kanyang galit.

27. Este año planeamos viajar a España durante las vacaciones de verano.

28. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

29. You're stronger than this, pull yourself together and fight through the tough times.

30. She found her passion for makeup through TikTok, watching tutorials and learning new techniques.

31. Nakipagtagisan sya ng lakas sa mga kalaban.

32. Si Ranay ay isang matakaw na batang nakatira sa mahirap na bayan ng Sto. Domingo.

33. They have bought a new house.

34. Nakikita ko ang halinghing ng mga bata habang naglalaro sa parke.

35. Kapag niluluto ni Tatay ang adobo, ang amoy ay sobrang mabango at nakakagutom.

36. Ako ang mas nagulat nang hapasin ni Maico sa hita si Mica.

37. Grande is renowned for her four-octave vocal range, often compared to Mariah Carey.

38. It's never a good idea to let the cat out of the bag when it comes to confidential information - it can have serious consequences.

39. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

40. Hindi ho, paungol niyang tugon.

41. Mabait ang mga kapitbahay niya.

42. Las escuelas públicas son financiadas por el estado y son gratuitas para los estudiantes.

43. Maraming Pinoy ang magaling sa pagluluto ng mga lutong bahay.

44. Nagitla ako nang biglang mag-ding ang doorbell nang walang inaasahan.

45. Paparami iyon at pumapaligid sa kanya.

46. He is also remembered for his generosity and philanthropy, as he was known for his charitable donations and support of various causes

47. He admires the athleticism of professional athletes.

48. All these years, I have been grateful for the opportunities that have come my way.

49. Receiving good news can create a sense of euphoria that can last for hours.

50. Naglipana ang mga ibon sa hardin ngayong tag-araw.

Recent Searches

maliksilumbaymagdoorbellkasamahankasalukuyangindvirkningnakarinigagadpunogayunmanenchantedanitarangkahanmayotinanongnoonilalangprutastransportmidlersinisirasabayhetoprinsesabaovidtstraktclockkotsekinapanayamdyosaganapmababatidhumakbanginirapanbarongnananalo1970stonetteinterviewingkastilasettingwaringmahigpitbusiness,followed1954magdasubalitpollutionmagulayawnalugmokbusinessesikinabubuhaynagtatrabahomagkapatidgirlgawinactualidaduwitahanankastilangpakipuntahantamiskinakainmakulitricoiniisipgulangiyonnahigacolorsitawipaliwanagpag-ibigmrskapeyaribumigaynilulonnuonsemillasfuelteleviewingmamataanagilityinaloktvspagkamulatdali-dalicreatingactivitygotkitbadingbobotomamamanhikanemnermagpapaligoyligoykumalatlapissumunodumiibigsutilnakataassilyanapatawadgayunpamanmagagamitnapuyatnagkakatipun-tiponunahinbarriersconnectingbroadcastserapfilmhugis-ulobigayiwananbeginningkalikasantiyakumulogmalasatensyonnagkakakainsikipnangyayaritigrealanganpamilyaisinaboynagsidalopagbatiinabottinaposiginitgitnagdaostemparaturakanyanaiwangplatformmagkasakitumigibpalibhasadollysabadonapapikitoutpostworkdaysiksikanlandlinenagpakunotnaglaonnapapag-usapanmisusedsusiinterpretingbumaliknangangalogkawili-wiliearlyeksport,luisgayaramdampagkaawaamerikaclearbusilakpagkuwanbagkus,pinoymatalikyorkaksidentenagwagibinibiniisusuotmadalingaktibistayourself,tuwingestospagkalungkotsystematiskconclusion,pinsandinaluhanpagkasabiiligtasnapakahangakayaseryosongnakaliliyongbulaklakpagsasalitatatagalnabighaniphilanthropyobserverer