Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "kapasyahan"

1. Nasa iyo ang kapasyahan.

Random Sentences

1. La escasez de agua es un desafío global que afecta a muchas regiones del mundo.

2. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

3. Ang mga batikang mang-aawit at musikero ay karaniwang itinuturing bilang mga alamat sa larangan ng musika.

4. Money can be earned through various means, such as working, investing, and entrepreneurship.

5. Are you crazy?! Bakit mo ginawa yun?!

6. Después de la clase de yoga, me siento relajada y renovada.

7. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

8. Pagtataka ko kung bakit hindi mo pa rin napapansin ang aking mga ginagawa para sa iyo.

9. Maasim ba o matamis ang mangga?

10. Unrealistic expectations can contribute to feelings of frustration and disappointment.

11. Los agricultores merecen ser valorados y respetados por su trabajo duro y su contribución a la sociedad.

12. Limitations can be a source of motivation to push oneself to achieve more.

13. Sa kasal, ang mga dalagang kasama ng bride ay nagdadala ng mga bulaklak at kumakanta.

14. Hindi dapat natin balewalain ang pag-unlad ng ating komunidad, samakatuwid.

15. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

16. The cuisine in Los Angeles reflects its diverse population, offering a wide range of international and fusion culinary experiences.

17. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

18. Tumigil muna kami sa harap ng tarangkahan bago pumasok sa simbahan.

19. Tumama ang aming kapitbahay sa lotto.

20. Landet er hjemsted for en række store virksomheder, der eksporterer til hele verden

21. Sa aking balkonahe, ako ay nagtatanim ng mga maliit na halaman upang magkaroon ng kahit konting berdeng espasyo.

22. I usually like to tell a joke to break the ice at the beginning of a presentation.

23. Sa aming probinsya, makikita mo ang mga bukid na mayabong na mga tanim.

24. Yung totoo? Bipolar ba itong nanay ni Maico?

25. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

26. Magkano ang bili mo sa iyong cellphone?

27. Grover Cleveland, the twenty-second and twenty-fourth president of the United States, served from 1885 to 1889 and from 1893 to 1897, and was known for his economic policies and opposition to corruption.

28. He plays the guitar in a band.

29. Este plato tiene un toque picante que lo hace especial.

30. Gusto. pag-amin ko kasi gutom na gutom na talaga ako.

31. He is having a conversation with his friend.

32. Sa gitna ng laban, nagbabaga ang determinasyon ng boksingero na manalo.

33. The cake was so light and fluffy; it practically melted in my mouth.

34. Electric cars can be charged using various methods, including home charging stations, public charging stations, and fast charging stations.

35. Users can create and customize their profile on Twitter, including a profile picture and bio.

36. Salah satu bentuk doa yang populer di Indonesia adalah sholat, yang merupakan salah satu rukun Islam.

37. Climate change is one of the most significant environmental challenges facing the world today.

38. Mahalaga ang listahan para sa mga malilimutin tulad ni Lita.

39. Kucing adalah salah satu hewan peliharaan yang populer di Indonesia.

40. Hindi dapat natin husgahan agad ang mga taong bukas palad sa kanilang buhay dahil baka sila pa ang tunay na maligaya.

41. Rutherford B. Hayes, the nineteenth president of the United States, served from 1877 to 1881 and oversaw the end of Reconstruction.

42. Ang daming linta sa bundok na kanilang inakyat.

43. Umuwi na ako kasi pagod na ako.

44. A medida que la tecnología avanzó, se desarrollaron nuevos tipos de teléfonos, como los teléfonos inalámbricos, los teléfonos móviles y los teléfonos inteligentes

45. Ang pag-asa ay nagbibigay ng inspirasyon sa mga tao upang maglingkod sa kanilang komunidad at sa ibang tao.

46. Las serpientes tienen una lengua bifurcada que utilizan para captar olores y explorar su entorno.

47. Presley's influence on American culture is undeniable

48. Lumiwanag ang paligid dahil sa paputok.

49. Chris Paul is a skilled playmaker and has consistently been one of the best point guards in the league.

50. All these years, I have been working to make a positive impact on the world.

Recent Searches

kapasyahantemperaturabutikividenskabjingjingipinatawagnag-emailnakatuonumagawkanginamahulognapuyatpagkuwantabingtumiramauliniganyouthnakatitigpumilihimutokpagbibiropakukuluanapelyidotulisanmilyongtog,inaabottotoolagnatnavigationalas-dosevolucionadocountrytaximahabangnagbentamaghapontinikmanpanginoonpatakbongpaaralaniniresetalumiitnilaosgubatvictoriatandangmagselosmahabolmahalmalalakisinocombatirlas,kailanmanahhhhretirarmatangkaddisciplinmarinigagilapaglayasfollowednangingilidmatandangfollowingmakalingporgatolunconstitutionaltanyaghinugotganunfederalkutsilyococktailsikipbalinganandoypalibhasapnilitpaggawalupainngipingtawananadmiredrecibirsayaomfattendebilanginmatitigasyorknanaypinagmakulitituturonapapikito-orderilagaykunwapinatiratulalatomorrowsurroundingsmaalwangpa-dayagonallifeaksidentenataposalaydagatcapacidadbalatimagesmayroongginawaandresnyankuwebabumilinatulogkahusayankirotanatinitindahversumuotkinainiyansumigawstoapoygoalhappenedlegacyyariltodikyam1950smayamanrestaurantibinentamatatalinogoodeveningcelularesmangingisdainulitbinasapanohaybevaretreslalapakilutosignbinilhanfamelarovelstandlumulusobwashingtoninformedbinatobrindartoothbrushbatobinibinidalawrolandsalatonightsaidpiecesmamimiliamerikacalciummayroonhojasingatancineweremakasarilingblazingnitongbumababarestawanscientistsumasambacommissionschoolsabonoibalikbasahanjokeisugakamatisfeltsinipangcardhearnam