Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "culture"

1. Football is known for its intense rivalries and passionate fan culture.

2. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

3. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

4. La motivation peut être influencée par la culture, les valeurs et les croyances de chacun.

5. Nationalism often emphasizes the importance of a common language, culture, and history.

6. Presley's influence on American culture is undeniable

7. The Lakers' success can be attributed to their strong team culture, skilled players, and effective coaching.

8. The United States has a complex and diverse food culture, with regional specialties and international cuisine.

9. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

10. Today, Presley is widely considered to be one of the most important figures in American music and culture

11. Twitter has become an integral part of online culture, shaping conversations, sharing opinions, and connecting people across the globe.

12. Women have been celebrated for their contributions to culture, such as through literature, music, and art.

13. Workplace culture and values can have a significant impact on job satisfaction and employee retention.

Random Sentences

1. Ano ang naging sakit ni Tita Beth?

2. Marunong nang maglinis at magtago ang mga taong marurumi.

3. Sa palagay ko, pangit ang kotse ng tiyo ko.

4. Nagkaroon siya ng pagkakataon na makita ang kanyang dating kasintahan, ngunit sa halip na bumati, bigla siyang naglimot at nagkunwaring hindi niya ito nakita.

5. Work can be challenging and stressful at times, but can also be rewarding.

6. Nanunuri ang mga mata at nakangising iikutan siya ni Ogor.

7. The presentation was absolutely flawless; you did a great job.

8. Sa takip-silim, nakakapagbigay ng romantikong vibe sa mga tao.

9. Los granjeros deben estar atentos al clima para saber cuándo es el mejor momento para cosechar.

10. Hindi inamin ni Jose na sya ang nakabasag ng pinggan.

11. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

12. Las escuelas tienen diferentes especializaciones, como arte, música, deportes y ciencias.

13. Tinawag nya kaming hampaslupa.

14. He missed his flight and then his luggage got lost. That just added insult to injury.

15. Den danske økonomi er bygget på en kombination af markedsekonomi og offentlig regulering

16. Rapunzel is a girl with long, magical hair who is locked in a tower until a prince comes to her rescue.

17. Kahit hindi ka magaling sa pagguhit, puwede ka pa ring matuto at mag-improve sa pagguhit.

18. Pero bigla na lang siyang hindi nagpakita.

19. Kailangan nating magtiyaga at magsumikap sa ating mga pangarap, datapapwat ay hindi ito agad-agad natutupad.

20. L'argent est un élément essentiel de notre vie quotidienne.

21. Naramdaman ko ang pagdidilim ng aking paningin nang biglang nagpakalma ang mundo sa aking paligid.

22. Marami silang pananim.

23. Nagalit ang matanda at pinalayas ang babaeng madungis.

24. Sa palaruan, maraming bata ang nag-aagawan sa isang bola.

25. Palaging sumunod sa mga alituntunin.

26. The hiking trail offers absolutely breathtaking views of the mountains.

27. Accepting the job offer without reading the contract was a risky decision.

28. Mi amigo y yo nos conocimos en el trabajo y ahora somos inseparables.

29. Børn er en vigtig del af samfundet og vores fremtid.

30. Omelettes are a popular choice for those following a low-carb or high-protein diet.

31. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

32. Cancer can affect any part of the body, including the lungs, breasts, colon, skin, and blood.

33. Nagsusulat ako ng mga pangungusap sa papel upang ma-praktis ang aking bokabularyo.

34. Muchas ciudades tienen museos de arte que exhiben obras de artistas locales e internacionales.

35. Teka, pakainin na muna natin sila. ani Jace.

36. One of the most significant impacts of television has been on the way that people consume media

37. Ang mga nagtatagumpay sa negosyo ay madalas na itinuring bilang mga modelo ng tagumpay at inspirasyon para sa iba.

38. The team captain is admired by his teammates for his motivational skills.

39. Nous avons prévu une lune de miel en Italie.

40. Pariwisata religi menjadi daya tarik bagi wisatawan lokal dan mancanegara yang tertarik untuk mengunjungi tempat-tempat suci dan melihat praktik keagamaan yang unik di Indonesia.

41. The stock market is a platform for buying and selling shares of publicly traded companies.

42. May problema ba? nagtatakang tanong ni Maico.

43. Natutunan ko ang mga awiting Bukas Palad mula sa aking mga magulang na parehong Katoliko.

44. Ang salarin ay nahuli matapos ang matagal na manhunt ng mga awtoridad.

45. El equilibrio entre la ingesta de calorías y la actividad física es importante para mantener un peso saludable.

46. Nagkakatipun-tipon ang mga ito.

47. The nature of work has evolved over time, with advances in technology and changes in the economy.

48. Puti ang kulay ng pinto ng pamilyang Gasmen.

49. Ang tag-ulan ay isa sa mga panahon ng taon na nagdadala ng malakas na pag-ulan at kadalasang nagdudulot ng baha at landslides.

50. Ang pagpapakalbo ng kagubatan ay isa sa mga pangunahing dahilan kung bakit nagkakaroon ng pagkawala ng mga punong-kahoy.

Similar Words

cultures

Recent Searches

culturebubongnag-eehersisyomedyosteerakmaalispag-asakahirapanfindehavemagkaibiganleadersminsanproductividadbloggers,andrewpakakatandaanlikasgatolschoolhinabinaglabastorymaya-mayanginingisihanincidencekasakitkinumutanbinatilyobooksplagaskilalang-kilalaangkanoutlinedalagaarghlendingbecomesasamaisa-isakalayaandingjoymemorialpublishinginalokfourrightsipihitrelevantsorpresapagngiticultivatitahimpaghahabimakatuloggumawadelahvordanmasungite-commerce,nilalangmaingatsinungalingmahigit1929sisterdalawaharingbringtungawumikotniyonnangalaglagnasasalinankassingulangpitumponginspirationdesign,babaingvelfungerendetiyoadicionalesmakuhamatamantalagamakapagempakekasaysayansonidotvstupeloiiklimaaringdagacompostelareportermapunderholdercarlocebuanothernagpakitalasingnapakatagalnakapagreklamomagkaparehopagsasalitapupuntahankumpletopagkakamalimasayahinkinalakihankumikilospagtawaallowingmagagawaagadimporpinag-aaralanhelpedattorneyvaliosamanakbointerests,isinagotiligtasdepartmentnakauslingalagangbayangitsuraumigibrimasanihinbahagyaautomationtigasbinibiliinakyatpresleymariainvitationitongmaidlahatganasigealexandersigatanodailmentsitakfreelancerasinwordswidespreadcallertenderprosperreloproductioneffektivmayroonnaapektuhandaangellanakabanggagodipinabalikoutlinesbeintedemocraticbinabalikshockpalayancommunicationsgamessumangstonehamlaterstrategynuclearconsiderpapuntastudentssingerdaigdiguponefficientjuniomapadalimatagpuanakinfuncionesbitawanstudiedbroaddinala