Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "such"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. AI algorithms are constantly evolving and improving, with new advancements being made in fields such as deep learning and reinforcement learning.

3. AI algorithms can be used to automate tasks and improve efficiency in industries such as manufacturing and logistics.

4. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

5. Ailments can be a result of aging, and many older adults experience age-related ailments, such as arthritis or hearing loss.

6. Ailments can be a result of lifestyle choices, such as smoking or excessive alcohol consumption.

7. Ailments can be caused by various factors, such as genetics, environmental factors, lifestyle choices, and infections.

8. Ailments can be diagnosed through medical tests and evaluations, such as blood tests or imaging scans.

9. Ailments can be managed through self-care practices, such as meditation or physical therapy.

10. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

11. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

12. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

13. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

14. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

15. Antioxidant-rich foods, such as berries and leafy greens, can help prevent chronic diseases.

16. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

17. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

18. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

19. Before television, most advertising was done through print media, such as newspapers and magazines

20. Brad Pitt is known for his charismatic performances in movies such as "Fight Club" and "Ocean's Eleven."

21. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

22. Calcium-rich foods, such as dairy products and tofu, are important for bone health.

23. Cancer can be diagnosed through medical tests, such as biopsies, blood tests, and imaging scans.

24. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

25. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

26. Cancer is caused by a combination of genetic and environmental factors, such as tobacco use, UV radiation, and exposure to carcinogens.

27. Cancer patients may receive support from various healthcare professionals, such as oncologists, nurses, and social workers.

28. Cancer survivors can face physical and emotional challenges during and after treatment, such as fatigue, anxiety, and depression.

29. Cancer treatment can have side effects, such as nausea, hair loss, and weakened immune system.

30. Cate Blanchett is an acclaimed actress known for her performances in films such as "Blue Jasmine" and "Elizabeth."

31. Conservation efforts, such as protecting natural habitats and endangered species, are critical to maintaining a healthy environment.

32. Coping strategies such as deep breathing, meditation, or exercise can help manage feelings of frustration.

33. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

34. Dogs can be trained for a variety of tasks, such as therapy and service animals.

35. Don't be fooled by the marketing gimmick, there's no such thing as a free lunch.

36. Einstein's work led to the development of technologies such as nuclear power and GPS.

37. Electric cars can be equipped with advanced safety features such as collision avoidance and pedestrian detection systems.

38. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

39. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

40. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

41. Emphasis is an important component of artistic expression, such as in poetry and music.

42. Environmental protection can also have economic benefits, such as creating jobs in sustainable industries.

43. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

44. Football has produced many legendary players, such as Pele, Lionel Messi, and Cristiano Ronaldo.

45. Football players wear special equipment such as shin guards to protect themselves from injury.

46. Foreclosed properties may be sold with special financing options, such as low down payments or low interest rates.

47. Frustration can also be a symptom of underlying mental health issues such as anxiety or depression.

48. Frustration can be caused by external factors such as obstacles or difficulties, or by internal factors such as lack of skills or motivation.

49. He thought he was getting a free vacation, but I reminded him that there's no such thing as a free lunch.

50. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

51. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

52. Hockey has produced many legendary players, such as Wayne Gretzky, Bobby Orr, and Mario Lemieux.

53. Hockey players wear special equipment such as helmets, pads, and gloves to protect themselves from injury.

54. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

55. Human activities, such as pollution and deforestation, have a significant impact on the environment.

56. I know they're offering free samples, but there's no such thing as a free lunch.

57. I learned early on that there's no such thing as a free lunch - everything comes with a cost.

58. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

59. International cooperation is necessary for addressing global environmental challenges, such as climate change.

60. Investors can invest in a variety of asset classes, such as stocks, bonds, real estate, and commodities.

61. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

62. Jeg har aldrig mødt en så fascinerende dame før. (I have never met such a fascinating lady before.)

63. Johnny Depp is known for his versatile acting skills and memorable roles in movies such as "Pirates of the Caribbean" and "Edward Scissorhands."

64. Kings may have ceremonial duties, such as opening parliament or receiving foreign dignitaries.

65. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

66. Limitations can be cultural or societal, such as gender roles or stereotypes.

67. Limitations can be financial, such as a lack of resources to pursue education or travel.

68. Limitations can be physical disabilities, such as hearing or vision loss, or mental health conditions, such as anxiety or depression.

69. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

70. Many churches hold special services and processions during Holy Week, such as the Stations of the Cross and the Tenebrae service.

71. Many cultures have traditional sweet treats, such as baklava, churros, and mochi.

72. Market indices such as the Dow Jones Industrial Average and S&P 500 can provide insights into market trends and investor sentiment.

73. Mathematical concepts, such as fractions and decimals, are used in daily life, such as cooking and shopping.

74. Mathematical concepts, such as geometry and calculus, are used in many everyday activities.

75. Mathematics has many practical applications, such as in finance, engineering, and computer science.

76. Mathematics provides the foundation for other sciences, such as physics and engineering.

77. Medical technology has also advanced in the areas of surgery and therapeutics, such as in robotic surgery and gene therapy

78. Microscopes can also be used to analyze the chemical composition of materials, such as minerals and metals.

79. Money can be earned through various means, such as working, investing, and entrepreneurship.

80. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

81. Musk has faced criticism over the safety of his companies' products, such as Tesla's Autopilot system.

82. Musk's innovations have transformed industries such as aerospace, automotive, and transportation.

83. Nationalism is often associated with symbols such as flags, anthems, and monuments.

84. Nicole Kidman is an Academy Award-winning actress known for her performances in movies such as "Moulin Rouge!" and "The Hours."

85. Oh gosh, you're such an ambisyosang frog!

86. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

87. Oscilloscopes have various controls, such as vertical and horizontal scaling, timebase adjustments, and trigger settings.

88. Patients may need to follow certain rules and restrictions while hospitalized, such as restricted diets or limitations on visitors.

89. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

90. Proper maintenance, such as regularly oiling the pivot point and cleaning off debris, can prolong the lifespan of scissors.

91. Regular grooming, such as brushing and bathing, is important for a dog's hygiene.

92. Representatives can be found at various levels of government, such as local, regional, national, or international.

93. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

94. She was excited about the free trial, but I warned her that there's no such thing as a free lunch.

95. Smoking can also increase the risk of other health issues such as stroke, emphysema, and gum disease.

96. Smoking cessation can lead to improved mental health outcomes, such as reduced anxiety and depression symptoms.

97. Smoking cessation programs and resources are available to help individuals quit smoking, such as nicotine replacement therapy and counseling.

98. Smoking is influenced by various factors, such as peer pressure, stress, and social norms.

99. Smoking is more common among certain populations, such as those with lower socioeconomic status and those with mental health conditions.

100. Some ailments are contagious and can spread from person to person, such as the flu or COVID-19.

Random Sentences

1. They are not running a marathon this month.

2. La pobreza extrema puede llevar a la inseguridad alimentaria y la desnutrición.

3. Magalang na nagpakumbaba si John nang makita ang matanda sa kalsada at tinulungan ito.

4. Kanino ka nagpatimpla ng cocktail drink?

5. Ano ho ang gusto ninyong orderin?

6. Drinking enough water is essential for healthy eating.

7. Di na niya makuha pang ipasok ang pisi ng beyblade upang mapaikot ito.

8. ¿Qué planes tienes para el Día de los Enamorados?

9. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

10. Tumawa nang malakas si Ogor.

11. Kumaripas si Lito nang makita niyang naglalakad na papalapit ang guro niya.

12. He has been named NBA Finals MVP four times and has won four regular-season MVP awards.

13. Yumabong ang interes ng mga kabataan sa pag-aaral ng STEM (Science, Technology, Engineering, at Mathematics) na may magandang kinabukasan.

14. Selain sholat, orang Indonesia juga melakukan doa melalui upacara adat dan keagamaan.

15. Bumalik siya sa Pilipinas nang biglaan dahil may emergency sa kanilang pamilya.

16. Si Datu Duri ay matandang-matanda na.

17. L'intelligence artificielle peut aider à optimiser les processus de production industrielle.

18. Después de haber viajado por todo el mundo, regresé a mi ciudad natal.

19. Advanced oscilloscopes offer mathematical functions, waveform analysis, and FFT (Fast Fourier Transform) capabilities.

20. There were a lot of boxes to unpack after the move.

21. Mabilis nyang kinuha ang laptop upang tapusin ang kanyang nobela.

22. Kapag may mga hindi malinaw na plano sa buhay, maaaring magdulot ito ng agam-agam sa mga tao.

23. Kahit hindi ako nagpapakita ng kilos, crush kita pa rin sa loob ng puso ko.

24. Madamot ang matanda tuwing may pupunta sa kanyang tahanan upang humingi ng tulong, agad niyang pinalalayas ang mga ito.

25. Pagkalipas ng dalawang linggo ay nakatanggap si Nicolas ng sulat galing kay Haring Bernardo.

26. Sa pagsasaayos ng aming barangay hall, nagkaroon kami ng malaking tagumpay dahil sa bayanihan ng mga residente.

27. John and Tom are both avid cyclists, so it's no surprise that they've become close friends - birds of the same feather flock together!

28. He has been gardening for hours.

29. Wag ka nang malumbay dahil nandito naman ako.

30. Tumigil muna kami sa harap ng tarangkahan bago pumasok sa simbahan.

31. Cancer can affect any part of the body, including the lungs, breasts, colon, skin, and blood.

32. A dedicated employee goes above and beyond their job requirements to contribute to the success of their organization.

33. Nagsilabasan ang mga taong bayan.

34. Marahil ay mahirap para sa akin na magpasya sa ngayon.

35. Ano pa ho ang kailangan kong gawin?

36. Hindi natinag si Kablan sa loob ng kanyang tindahan.

37. May bagong aklat na inilathala ukol kay Manuel Quezon at tungkol ito sa pag-unlad ng teknolohiya.

38. Ariana is also an accomplished actress in film, with roles in movies like Don't Look Up (2021).

39. The website's loading speed is fast, which improves user experience and reduces bounce rates.

40. May lagnat, sipon at ubo si Maria.

41. Ang mahal naman ng laptop na binili ni Andy.

42. Storm can control the weather, summoning lightning and creating powerful storms.

43. The children eagerly lined up for their share of the birthday cake.

44. Madalas na nagiging dahilan ng utang ang kawalan ng sapat na pera upang matugunan ang mga pangangailangan.

45. Sa bawat pagkakataon, dapat nating ipaglaban at ipagtagumpay ang ating kalayaan.

46. Nagitla ako nang biglang bumagsak ang mga plato sa kusina.

47. Naisip ko ang aking dating kasintahan, datapwat alam kong masaya na siya sa kanyang bagong relasyon.

48. Maramot siya sa pagkain kaya hindi niya binibigyan ang kanyang mga kapatid.

49. Les prêts sont une forme courante de financement pour les projets importants.

50. Matagal nang hindi niya nabanggit ang pangalan ng kaibigan niya, kaya parang naglimot na siya rito.

Recent Searches

iniangatnakakasamasuchnapag-alamannapabalikwasnagpapaypaynamumulaklaknakapapasongnahuhumalingnahahalinhannagsipagtagonagre-reviewsinonagpapanggapkasamanag-aasikasomisteryosongnakatiracommunicatemapagkalingalalakadibiliparatingnanunuksonahantadpinakidalaenergibabamanggagalingnagpapakainchoosenag-uwingingisi-ngisingkahoyhinigittoyunconventionalpaghuhugasmamamanhikanmotionminamasdantermminatamisnareklamoconectadosallowingflynaglulusakmaistorbomagalitwordsbringclientesmakapaibabawmagpasalamatmagpapabunotexpectationslabing-siyam1000dumaramijacesatisfactionanywhereenvironmentharingdisappointedcallmakahiramresearch:startmaayosmakaratinghoneymoonersconsiderjunjunimporsaan-saancombatirlas,tinataluntongenerationeralintuntuninguideunderholderpaulit-ulitbeforemagsisimulatemperaturatabingdagatpuedesunud-sunodsystemmarangalsinunggabankababayansinungalingpunung-punopunongkahoypunong-punopinagsasabimagka-apolinggopinagalitanjejupasasalamatpapagalitanpanunuksongthroatpanghimagasdonehalospamimilhingpagsasalitakapilingpagmamanehopagkakataonjudicialdamitpagkakamalibumilipagkakahiwanapakalakipaghalakhakmahalaganasasalinannapatingalafilmikinasasabikresultmartanapapatungomarknapapahintonapakalusognapakabangonangingisaypamangkinnakikihukaynakangitingnakakatandahulumakikipagbabagtinginreaksiyonnakagagamotkoreanagtinginanbitbitnagtatakangnagpipiknikformanagpapaigibnagkantahannageenglishgumagawatumamistshirtmapangasawamaninirahanpalagaymangingisdapasosmanghikayatmakakabaliktotoomagpagalingmagkababatamagbabagsikmababangongkinakawitanmakitakinaiinisankinagabihankaratulanguusapanforståkababaihankalawangingbingbingdalagangkabarkadadali-dalingmaanghangrequierenmagsusuotintsik-behomalulungkotcorporationhila-agawancomplicatedgenerationstugisumasaliwuugud-ugodultimatelythroughouttelevisiontelebisyonstrategiesscientificsarisaring