Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

27 sentences found for "hay"

1. Cuídate mucho en ese barrio, hay algunas zonas peligrosas.

2. En la realidad, hay muchas perspectivas diferentes de un mismo tema.

3. En la realidad, no hay atajos para alcanzar el éxito.

4. Es útil llevar un powerbank cuando se viaja, especialmente en lugares donde no hay acceso a enchufes eléctricos.

5. Está claro que hay diferencias de opinión en este asunto.

6. Hay miles de especies de serpientes en todo el mundo, con una amplia variedad de tamaños, colores y hábitats.

7. Hay muchas formas de arte, como la pintura, la escultura, la danza y la música.

8. Hay muchas hojas en el jardín después de la tormenta.

9. Hay muchos géneros de música, como el rock, el pop, el jazz y el clásico.

10. Hay muchos riesgos asociados con el uso de las redes sociales, como el acoso cibernético.

11. Hay naku, kayo nga ang bahala.

12. Hay una gran cantidad de recursos educativos disponibles en línea.

13. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

14. Hit the hay.

15. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

16. Los powerbanks pueden prolongar la duración de la batería de un dispositivo móvil cuando no hay acceso a una toma de corriente.

17. Los powerbanks también son útiles para actividades al aire libre, como acampar o hacer senderismo, donde no hay acceso a la electricidad.

18. Muchas escuelas ofrecen clases de música y hay numerosas instituciones educativas especializadas en música, como conservatorios y escuelas de música

19. No hay mal que por bien no venga.

20. No hay mal que por bien no venga. - Every cloud has a silver lining.

21. No hay nada más poderoso que un sueño respaldado por la esperanza y la acción. (There is nothing more powerful than a dream backed by hope and action.)

22. No hay palabras suficientes para agradecer tu amor y apoyo.

23. No hay peor ciego que el que no quiere ver. - There's none so blind as those who will not see.

24. No hay que buscarle cinco patas al gato.

25. No hay que perder la paciencia ante las adversidades.

26. Siempre hay esperanza, incluso en las situaciones más difíciles. (There is always hope, even in the most difficult situations.)

27. Siempre hay que tener paciencia con los demás.

Random Sentences

1. The early bird catches the worm.

2. He continues to be an inspiration to generations of musicians and fans, and his legacy will live on forever

3. Masdan mo ang aking mata.

4. Magkano po sa inyo ang yelo?

5.

6. Saan nyo balak mag honeymoon?

7. Nang suriin nila ito ay nakita ang isang insektong kumakain ng kahoy.

8. Malalapad ang mga dahon ng halaman na ito at walng mga sanga.

9. Ibig sabihin, nagpepeke pekean ka lang ng luha kanina?!

10. Nasisilaw siya sa araw.

11. Si te gusta la comida picante, prueba el guacamole con jalapeño.

12. Ano ang pangalan ng doktor mo?

13. Protecting the environment involves balancing the needs of people and the planet.

14. Ano ang pinapanood mo sa telebisyon?

15. At ignorere sin samvittighed kan føre til skyldfølelse og fortrydelse.

16. Les chatbots d'intelligence artificielle peuvent aider les entreprises à répondre aux demandes des clients.

17. Nagbigay ng malaking tulong sa akin ang aking guro sa paghahanda sa aking thesis.

18. She's always creating drama over nothing - it's just a storm in a teacup.

19. Nagmadali kaming maglakad papalapit kay Athena at Lucas

20. Isang umaga habang si Nicolas ay nasa paaralan ay nabalitaan niya na paalis na sina Helena papunta sa ibang bansa mamayang hapon.

21. Emphasis can be used to highlight a person's strengths and abilities.

22. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

23. La robe de mariée est magnifique.

24. Nagdala si Butch ng laruan para sa bata.

25. Kakutis ni Kano ang iba pa niyang kapatid.

26. Congrats Beast! Proud girlfriend here! natatawang sabi ko.

27. Nationalism has played a significant role in many historical events, including the two World Wars.

28. Le livre que j'ai lu était très intéressant.

29. Kapag nasa agaw-buhay na sitwasyon, kailangan nating mag-ingat at magtulungan para sa ating kaligtasan.

30. Bigla, ubos-lakas at nag-uumiri siyang umigtad.

31. Después de caminar por la ciudad, descubrimos un nuevo restaurante.

32. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

33. Malapalasyo ang bahay ni Ginang Cruz.

34. At ginawaran ng isang matamis na halik ang labi ng naguguluhang si Mariang Maganda.

35. The symptoms of pneumonia include cough, fever, and shortness of breath.

36. She is not drawing a picture at this moment.

37. El parto natural implica dar a luz a través del canal vaginal, mientras que la cesárea es una operación quirúrgica que implica hacer una incisión en el abdomen de la madre.

38. Landet er et godt eksempel på, hvordan man kan skabe en velfungerende

39. Sa pulong ng mga magulang, ibinahagi nila ang mga mungkahi para sa mas magandang edukasyon ng mga bata.

40. Electric cars can be charged using various methods, including home charging stations, public charging stations, and fast charging stations.

41. Le stress peut avoir des effets néfastes sur la santé mentale et physique.

42. Claro que sí, estoy dispuesto a aprender cosas nuevas.

43. Mag-ingat sa aso.

44. Isang maliit na kubo ang nakatayo sa itaas ng baranggay, sa tagiliran mismo ng bundok na balot ng makapal na gubat.

45. She is not cooking dinner tonight.

46. Det er vigtigt at give børn en kærlig og støttende opvækst.

47. Facebook Messenger is a standalone messaging app that allows users to have private conversations with friends and contacts.

48. Nagtatanim kami ng mga halamang gamot para sa aming natural na gamutan.

49. Matapos ang isang matinding pagsubok, hindi maiwasan ang paglabas ng malalim na himutok.

50. Sop buntut adalah sup yang terbuat dari ekor sapi dengan rempah-rempah dan sayuran yang kaya rasa.

Similar Words

bahayhayopPagkabuhayBuhaypambahayKapitbahayHayaannabubuhaybahay-bahayanhayaangmamuhaynamuhayhanapbuhayHanap-buhaypamumuhaykabuhayanagaw-buhayikinabubuhayma-buhaymabuhaykapit-bahaykinabubuhaybahay-bahaypanghabambuhaynabuhaymabubuhaymay-bahaynakatunghay

Recent Searches

haytiniochoioperahandiscoveredmaaarilookedtupelolagimaingatpaskoexcuselosssalahousemeaningbilugangresortwaricitizenbalancescomunicannagdasalmenuothers,fertilizerpostcardcomienzansinipangsaanprimercollectionsusabuwanallottedilogconsistguiltynamungablessnatingarmeddanceumilingtipidlightsfatallibrenapasigawmagalanglastingpartvasquesbubongfeelingexperthardnalasingbumugasciencecoachingbellmartialaccessneedmorenagwo-worknegosyocuandoipinalitwithoutentryvancontrolledlearnspreadbasastatingbroadcastssusunodanitocondoabosiyudadmalezamaputikesonangyariilaningatankinaumagahanclippalabassakinbulalaslupangdinanaseffectprocesslumiitsumasagotpambansangkristogelaitilganggumigisingpakukuluanstaylaropumayagmaongothers1960sanumanaguakulisapgownkumapitdinukotkumukuhaagwadorkakahuyanpaumanhinkumakalansingfotosikinamataykaliwadalawanagpapasasamedya-agwanakasahodkinauupuannakalipaserhvervslivettumawaghubad-baronagpaiyakkabutihanpagsisisidiretsahangpupuntahannag-poutnapakasipagnawawalanapuyatpinigilanyouthbyggetpaghuhugasmahiyasallysuchkaninongmundoadvancementfulfillmentpapalapitnabigyanindustriyapagbibiromahalalletilimatalimpagsidlanipinangangakmusicallunashawlanangapatdannakabaonhumihingidisensyotumingalanawalapapayasubject,katagaanaambagdeterminasyonmakulitiyaklalongmaayospagkalungkotisinilangonlinenilulontillweretumangopongwashingtonriyanbinawiencompasseslutoagadipaliwanag