Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "effect"

1. But as in all things, too much televiewing may prove harmful. In many cases, the habit of watching TV has an adverse effect on the study habits of the young.

2. Einstein was awarded the Nobel Prize in Physics in 1921 for his discovery of the law of the photoelectric effect.

3. Einstein was awarded the Nobel Prize in Physics in 1921 for his explanation of the photoelectric effect.

4. LeBron has used his platform to advocate for social justice issues, addressing inequality and supporting initiatives to effect positive change.

5. The patient experienced hair loss as a side effect of chemotherapy for leukemia.

Random Sentences

1. Maramot ang kapitbahay nila at hindi nagpapahiram ng gamit kahit kailan.

2. Inakalang madali lang ang gawain, pero ito’y masalimuot pala.

3. Bumibili ako ng malaking pitaka.

4. Riega el maíz regularmente y asegúrate de que el suelo esté siempre húmedo

5. Laging may buslo ng bulak sa tabi ang lola, at isang mahabang patpat na kidkiran (huso, spindle) ng sinulid.

6. Bago ang kasal, nagkaruon muna sila ng seremonya kung saan nagmamano siya bilang bahagi ng pamamamanhikan.

7. The title of king is often inherited through a royal family line.

8. Sa bawat pagkakataon na pinagmamalupitan ako, lumalaki ang poot sa aking puso.

9. Pasensya ka na anak, ang lahat ng ginagawa namin ng iyong ama ay para sa iyo.

10. Sa dakong huli ng aking buhay, sana ay masabi ko na nagawa ko ang lahat ng gusto kong gawin.

11. La realidad es que a veces no podemos controlar lo que sucede.

12. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

13. Elektronisk udstyr kan hjælpe med at automatisere opgaver og reducere fejl.

14. May nadama siyang ginhawa ngunit pansamantala lamang iyon.

15. Naalala ni Mang Kandoy ang abo ng puso ni Rodona na kanyang itinago.

16. Auf Wiedersehen! - Goodbye!

17. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

18. Das Gewissen kann uns helfen, die Folgen unserer Handlungen besser zu verstehen.

19. Limiting the consumption of processed foods and added sugars can improve overall health.

20. Isang malaking pagkakamali lang yun...

21. Napakaganda ng mga pasyalan sa bansang Singapore.

22. Isinaboy niya ang tubig na nasa harap.

23. Si Maria ay na-suway sa utos ng guro na tapusin ang kanyang takdang gawain.

24. Ang pagtuturo ng mga guro ay nagpapalaganap ng kaalaman at abilidad sa mga mag-aaral.

25. Me gusta recolectar hojas secas en el parque y hacer manualidades con ellas.

26. Dahil sa maayos na pamamahala, yumabong ang ekonomiya ng bansa.

27. Waring may kakaibang nararamdaman siya, ngunit hindi niya ito maipaliwanag.

28. She speaks three languages fluently.

29. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

30. Air susu dibalas air tuba.

31. Las escuelas tienen diferentes especializaciones, como arte, música, deportes y ciencias.

32. The authorities were stumped as to who the culprit could be in the unsolved case.

33. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

34. Gumagawa ng cake si Bb. Echave.

35. Dalam Islam, kelahiran bayi yang baru lahir diiringi dengan adzan dan takbir sebagai bentuk syukur kepada Allah SWT.

36. Der er ingen fastlagte regler for, hvordan man bliver kvinde, det er en individuel proces.

37. Palibhasa ay karaniwan nang nakakamit ang kanyang mga layunin dahil sa kanyang determinasyon at tiyaga.

38. Les enseignants sont formés pour répondre aux besoins individuels des étudiants.

39. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

40. Las fiestas invernales, como el Día de Reyes, traen alegría y celebraciones.

41. Ang bawa't isa ay may kanya-kanyang ginagawa.

42. Foreclosed properties may be sold through auctions, which can be a fast-paced and competitive environment.

43. Hawak nito ang isang maliit na bangos na tig-bebente, sa loob-loob ni Aling Marta.

44. I reached my credit limit on the card and couldn't make any more purchases.

45. Ang maalikabok at baku-bakong lansangan ng Nueva Ecija ay kanyang dinaanan.

46. Ang kanyang tula ay punong-puno ng panaghoy at pag-asa.

47. They offer interest-free credit for the first six months.

48. Hindi niyang inaasahang may dadalaw sa kanya sa mahabang panahon inisp niya na imposible ito

49. ¿Quieres que le agregue un poco de picante a tu comida?

50. Matapos ang isang matinding pagsubok, hindi maiwasan ang paglabas ng malalim na himutok.

Similar Words

effects

Recent Searches

messageeffectquicklycomunicarsehulingbawatumarawgoingipongguiltyeyegagawinsalarinbarrocomakaratingbutihingtoreteadicionalespangitcelularestanodsuotsemillasleadingnaggalabusyanglamesabilinaccedermodernasulsiyamadamiusagearsubalitbinawiinantokorasanmaputidigitalbabeibabaimprovekiloenforcingilanatefiguresinalalayanadvancedbranchesrefersmulalabasdevelopedadverselycornersbipolarnilinisflexiblesobramemoriallegendsinilalabaskalalakihannasisiyahanphilippineamericanmerlindanasasakupanhelloluluwassiniyasatmakapalalmacenarpagpapakainshifthumanapgreatercreatedalfredageswidetutoringtelecomunicacionesphilanthropypagamutanpopularcriticsclimaothersvitaltmicanamawidelysatisfactionnapakaningningomelettepagraranasayasystems-diesel-runkababalaghangkakahuyanpeopleotsomasokguitarragiraybusyabut-abotinternalhitbusiness:1920sbukasnakaspendingpinamalaginawawalanakayukolumilipadyansumalamamioverviewreportschedulenewkumapitpintonagliwanagcondonagwelgamakikiligokontinentengsantosumabogcoinbasepookhamakpagpasensyahannagtungonakataposinilabasseryosongkinumutanlinggo-linggoitinaaspangakomachinesmukamagkabilangfascinatingpublishingsarilingbaopirataso-calledyouulitnamingnagreplyhmmmledschoolfrogcynthiaiiwasanmagpakaramiunansumalakaysukatinstageoftecomunespinunitlorenabubongmaibabaliktoynalulungkotmakikipaglarotiningnaniyaksalatintomorrowhangintiyanmagpagalingtonwayyearbugtongramdamsumamasellsincemauliniganmawawala