Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

87 sentences found for "many"

1. Ailments can be a result of aging, and many older adults experience age-related ailments, such as arthritis or hearing loss.

2. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

3. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

4. Antiviral medications can be used to treat some viral infections, but there is no cure for many viral diseases.

5. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

6. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

7. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

8. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

9. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

10. But as in all things, too much televiewing may prove harmful. In many cases, the habit of watching TV has an adverse effect on the study habits of the young.

11. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

12. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

13. Cryptocurrency has faced regulatory challenges in many countries.

14. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

15. Despite the many advancements in television technology, there are also concerns about the effects of television on society

16. Einstein was a member of the Institute for Advanced Study at Princeton University for many years.

17. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

18. Einstein's writings on politics and social justice have also had a lasting impact on many people.

19. Football has a rich history and cultural significance, with many traditions and customs associated with the sport.

20. Football has produced many legendary players, such as Pele, Lionel Messi, and Cristiano Ronaldo.

21. Football is a popular sport for both men and women, with many professional women's leagues around the world.

22. Foreclosed properties can be found in many areas, including urban, suburban, and rural locations.

23. He has traveled to many countries.

24. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

25. Hockey has produced many legendary players, such as Wayne Gretzky, Bobby Orr, and Mario Lemieux.

26. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

27. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

28. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

29. It has been found that by abstaining from smoking a person may be cured of many diseases

30. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

31. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

32. Many charitable institutions rely on volunteers to sustain their programs.

33. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

34. Many churches hold special services and processions during Holy Week, such as the Stations of the Cross and the Tenebrae service.

35. Many companies use the stock market to raise capital by issuing new shares of stock to investors.

36. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

37. Many cultures have their own unique traditions and customs surrounding weddings.

38. Many cultures have traditional sweet treats, such as baklava, churros, and mochi.

39. Many dogs enjoy going on walks and exploring new environments.

40. Many fathers have to balance work responsibilities with family obligations, which can be challenging but rewarding.

41. Many financial institutions, hedge funds, and individual investors trade in the stock market.

42. Many people exchange gifts and cards with friends and family during Christmas as a way of showing love and appreciation.

43. Many people experience stress or burnout from overworking or job dissatisfaction.

44. Many people go to Boracay in the summer.

45. Many people start their day with a cup of coffee to help them wake up and feel more alert.

46. Many people think they can write a book, but good writers are not a dime a dozen.

47. Many people turn to God for guidance, comfort, and solace during difficult times in their lives.

48. Many people work to earn money to support themselves and their families.

49. Many politicians are corrupt, and it seems like birds of the same feather flock together in their pursuit of power.

50. Many religious traditions believe that God is all-knowing, all-powerful, and benevolent.

51. Many schools and universities now use television as a way to provide distance learning

52. Many wives have to juggle multiple responsibilities, including work, childcare, and household chores.

53. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

54. Mathematical concepts, such as geometry and calculus, are used in many everyday activities.

55. Mathematics has a long history and has contributed to many important discoveries and inventions.

56. Mathematics has many practical applications, such as in finance, engineering, and computer science.

57. Mathematics is an essential subject for understanding and solving problems in many fields.

58. Money can take many forms, including cash, bank deposits, and digital currencies.

59. Nationalism has played a significant role in many historical events, including the two World Wars.

60. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

61. Protecting biodiversity is important for the health of ecosystems and the survival of many species.

62. Smoking is prohibited in many public places and workplaces to protect non-smokers from secondhand smoke exposure.

63. Sweetness can be a source of comfort and pleasure for many people.

64. Television is one of the many wonders of modern science and technology.

65. Tengo muchos sueños y aspiraciones. (I have many dreams and aspirations.)

66. The artist's intricate painting was admired by many.

67. The celebration of Christmas has become a secular holiday in many cultures, with non-religious customs and traditions also associated with the holiday.

68. The exchange of rings is a common tradition in many weddings.

69. The foundation's charitable efforts have improved the lives of many underprivileged children.

70. The king's portrait appears on currency and postage stamps in many countries.

71. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

72. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

73. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

74. The telephone has undergone many changes and improvements since its invention

75. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

76. The uncertainty of the job market has led to many people rethinking their career paths.

77. The United States has a long-standing relationship with many countries around the world, including allies such as Canada and the United Kingdom.

78. The United States has been involved in many international conflicts, including World War I and World War II.

79. There are many different types of microscopes, including optical, electron, and confocal microscopes.

80. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

81. There are so many coffee shops in this city, they're a dime a dozen.

82. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

83. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

84. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

85. Women have been elected to political office in increasing numbers in recent years, though still underrepresented in many countries.

86. Women have faced discrimination and barriers in many areas of life, including education and employment.

87. Work is a necessary part of life for many people.

Random Sentences

1. Tantangan hidup dapat menjadi kesempatan untuk memperluas batasan diri dan mencapai potensi yang lebih besar.

2. Tantangan hidup memberikan kesempatan untuk memperluas kemampuan dan meningkatkan kepercayaan diri.

3. Det kan være svært for transkønnede personer at finde støtte og accept i deres familie og samfund.

4. Les personnes âgées peuvent bénéficier d'un régime alimentaire équilibré pour maintenir leur santé.

5. Nagtayo ng scholarship fund si Carlos Yulo para sa mga batang gustong mag-aral ng gymnastics.

6. Les personnes âgées peuvent être sujettes à des chutes et d'autres accidents.

7. Magkita na lang po tayo bukas.

8. Nagiging emosyonal ang mga panahon sa kasal, tulad ng mga pananalita ng mga magulang at mga kaibigan.

9. Ano ba problema mo? Bakit ba ayaw mong magpa-ospital?!

10.

11. Dapat bigyang-pansin ang pangamba ng mga bata at tulungan silang maunawaan ang mga posibleng banta.

12. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

13. Kailangan natin ng mga kubyertos para makakain ng maayos.

14. Cheating is a personal decision and can be influenced by cultural, societal, and personal factors.

15. He has become a successful entrepreneur.

16. Foreclosed properties can be a good investment opportunity for those who have the time and resources to manage a rental property.

17. Microscopes can be used to study living organisms in real-time, allowing researchers to observe biological processes as they occur.

18. Ang aking kabiyak ay ang aking kaligayahan at kabuuang kaganapan sa aking buhay.

19. Ang pagbabago ng pananaw at pag-iisip ay maaaring magdulot ng pagbabago sa pangamba.

20. Sorry, hindi ako babae eh. sumubo ako ng pagkain ko.

21. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

22. Beaucoup de gens sont obsédés par l'argent.

23. It's so loud in here - the rain is coming down so hard it's like it's raining cats and dogs on the roof.

24. Ang pagdidilim ng kalangitan ay nagpakalma sa init ng araw at nagbigay daan sa isang magandang sunset.

25. Nous avons opté pour une cérémonie de mariage intime.

26. Nalaman ko na ang kanyang halinghing ay dahil sa kanyang asthma.

27. ¿Quieres algo de comer?

28. Ang snob naman neto. Alam mo ba kung anong oras na?

29. Umalis sa sakayan ang mga pasahero nang limahan.

30. Pumasok sa sinehan ang mga manonood nang limahan.

31. Marahas ang kanyang pagkakapagsalita sa bata at maaaring may kakilala siyang nagdaraan na nakarinig ng kanyang mga sinabi.

32. The bride looked stunning in her wedding dress, truly a beautiful lady.

33. Work can also have a social aspect, providing opportunities to meet new people and make connections.

34. Hindi ko mapigilan ang sarili ko na mahumaling sa mga Korean dramas.

35. Inflation kann die Einkommen von Rentnern und Menschen mit festen Einkommen verringern.

36. She began her career in musical theater and appeared in the Broadway production 13 in 2008.

37. Parang nahulaan ng kanyang ina ang kanyang iniisip.

38. Det er vigtigt at have et støttende netværk af venner og familie under fødslen og i de første måneder efter fødslen.

39. Ano hong pitaka? ang sabi ng bata.

40. Nasi goreng adalah salah satu hidangan nasional Indonesia yang terkenal di seluruh dunia.

41. At leve med en god samvittighed kan hjælpe os med at opbygge stærke og tillidsfulde relationer med andre mennesker.

42. Maitim ang dugo ang madalas sabihin kapag masama ang isang tao

43. Inialay ni Hidilyn Diaz ang kanyang tagumpay sa Diyos at sa kanyang pamilya.

44. Kung papansinin mo'y lagi ka ngang mababasag-ulo.

45. Maliit lang ang kusina ni Lola Oliva.

46. La tos puede ser un síntoma de afecciones menos comunes, como la sarcoidosis y la fibrosis pulmonar.

47. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

48. Paano tayo? Di mo pa sinasagot yung tanong ko. aniya.

49. Paglingon niya, nakakita siya sa kanyang tabihan ng isang munting palaka na parang nakatinging sa kanya

50. Ganyan talaga ang buhay lagi kang nasasabihan.

Similar Words

Germany

Recent Searches

manyunonalagutanbangladeshmakilingagesevensunud-sunodlucasomelettecultureipabibilanggovariouscitizenreahgreateraplicacioneswalkie-talkieunosadversededicationsilbingbiyayangitspaglalabavitaminsencuestaskalayuansopaspapanigmapuputihigpitantagumpayginangkayongmatindiinyongtumulongnag-bookhalamansesameibabawmaingayhabangmaunawaanlibropracticeskaninumanbatohaynaminmagta-trabahosusunodcreatingreadmakakainpusoseeworkinguniquetechnologiespagdidilimwhichmakesbagamakahuluganforskelligefranciscokamotenag-asaranrichself-defenseuminomumagabanalperfectaledeterminasyonpilingtodaycharismaticlearndesarrollaronskillseparationkagyatbababanglittlebuhaymagandangbestidonyenaglabakombinationlookedpananakopbahay-bahaypinapataposipinagdiriwangaraymichaelnakatulogtagsiboltamadrequierenpinanooddiscipliner,bakamasayahinmagsaingmakakasahodpersonalnatuloyborgeresimplengkaawaybagalpagpanawmaipagpatuloygalitnahulogsupportnamalagiarawkuwartonoogumandanatuyomediapagapangresearch,1954shipamazonalituntuninbigyannitonglapatbuwissorryalsobetweenloob-loobipapautanglinteksoftwaremakalabascouldkinatatalungkuangpanahonkirbyinitmalakinapilingkinayavehiclesdefinitivoautomationperoinintayempresaspahingalmababangishinatidtilgangpaki-ulitsharkforma11pmgawin1977pamamasyalmaagapantumawahinigittoystuhodpaninigaspaketecommander-in-chiefnagtapospalakamagka-babypagdukwangkonsultasyonpaghalakhakbitaminacommunicationnakatitiyakmakaangalhawakkassingulangloansmaghintaycaroladvancementstiniklinglikelyestablished