Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

87 sentences found for "many"

1. Ailments can be a result of aging, and many older adults experience age-related ailments, such as arthritis or hearing loss.

2. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

3. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

4. Antiviral medications can be used to treat some viral infections, but there is no cure for many viral diseases.

5. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

6. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

7. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

8. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

9. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

10. But as in all things, too much televiewing may prove harmful. In many cases, the habit of watching TV has an adverse effect on the study habits of the young.

11. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

12. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

13. Cryptocurrency has faced regulatory challenges in many countries.

14. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

15. Despite the many advancements in television technology, there are also concerns about the effects of television on society

16. Einstein was a member of the Institute for Advanced Study at Princeton University for many years.

17. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

18. Einstein's writings on politics and social justice have also had a lasting impact on many people.

19. Football has a rich history and cultural significance, with many traditions and customs associated with the sport.

20. Football has produced many legendary players, such as Pele, Lionel Messi, and Cristiano Ronaldo.

21. Football is a popular sport for both men and women, with many professional women's leagues around the world.

22. Foreclosed properties can be found in many areas, including urban, suburban, and rural locations.

23. He has traveled to many countries.

24. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

25. Hockey has produced many legendary players, such as Wayne Gretzky, Bobby Orr, and Mario Lemieux.

26. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

27. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

28. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

29. It has been found that by abstaining from smoking a person may be cured of many diseases

30. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

31. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

32. Many charitable institutions rely on volunteers to sustain their programs.

33. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

34. Many churches hold special services and processions during Holy Week, such as the Stations of the Cross and the Tenebrae service.

35. Many companies use the stock market to raise capital by issuing new shares of stock to investors.

36. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

37. Many cultures have their own unique traditions and customs surrounding weddings.

38. Many cultures have traditional sweet treats, such as baklava, churros, and mochi.

39. Many dogs enjoy going on walks and exploring new environments.

40. Many fathers have to balance work responsibilities with family obligations, which can be challenging but rewarding.

41. Many financial institutions, hedge funds, and individual investors trade in the stock market.

42. Many people exchange gifts and cards with friends and family during Christmas as a way of showing love and appreciation.

43. Many people experience stress or burnout from overworking or job dissatisfaction.

44. Many people go to Boracay in the summer.

45. Many people start their day with a cup of coffee to help them wake up and feel more alert.

46. Many people think they can write a book, but good writers are not a dime a dozen.

47. Many people turn to God for guidance, comfort, and solace during difficult times in their lives.

48. Many people work to earn money to support themselves and their families.

49. Many politicians are corrupt, and it seems like birds of the same feather flock together in their pursuit of power.

50. Many religious traditions believe that God is all-knowing, all-powerful, and benevolent.

51. Many schools and universities now use television as a way to provide distance learning

52. Many wives have to juggle multiple responsibilities, including work, childcare, and household chores.

53. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

54. Mathematical concepts, such as geometry and calculus, are used in many everyday activities.

55. Mathematics has a long history and has contributed to many important discoveries and inventions.

56. Mathematics has many practical applications, such as in finance, engineering, and computer science.

57. Mathematics is an essential subject for understanding and solving problems in many fields.

58. Money can take many forms, including cash, bank deposits, and digital currencies.

59. Nationalism has played a significant role in many historical events, including the two World Wars.

60. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

61. Protecting biodiversity is important for the health of ecosystems and the survival of many species.

62. Smoking is prohibited in many public places and workplaces to protect non-smokers from secondhand smoke exposure.

63. Sweetness can be a source of comfort and pleasure for many people.

64. Television is one of the many wonders of modern science and technology.

65. Tengo muchos sueños y aspiraciones. (I have many dreams and aspirations.)

66. The artist's intricate painting was admired by many.

67. The celebration of Christmas has become a secular holiday in many cultures, with non-religious customs and traditions also associated with the holiday.

68. The exchange of rings is a common tradition in many weddings.

69. The foundation's charitable efforts have improved the lives of many underprivileged children.

70. The king's portrait appears on currency and postage stamps in many countries.

71. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

72. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

73. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

74. The telephone has undergone many changes and improvements since its invention

75. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

76. The uncertainty of the job market has led to many people rethinking their career paths.

77. The United States has a long-standing relationship with many countries around the world, including allies such as Canada and the United Kingdom.

78. The United States has been involved in many international conflicts, including World War I and World War II.

79. There are many different types of microscopes, including optical, electron, and confocal microscopes.

80. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

81. There are so many coffee shops in this city, they're a dime a dozen.

82. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

83. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

84. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

85. Women have been elected to political office in increasing numbers in recent years, though still underrepresented in many countries.

86. Women have faced discrimination and barriers in many areas of life, including education and employment.

87. Work is a necessary part of life for many people.

Random Sentences

1. Einstein's legacy continues to inspire scientists and thinkers around the world.

2. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

3. Malapit na naman ang eleksyon.

4. The website's analytics show that the majority of its users are located in North America.

5. Habang daan, samantalang patungo sa pamilihang-bayan ng Tondo, ay mataman niyang iniisip ang mga bagay na kanyang pamimilhin.

6. Her lightweight suitcase allowed her to pack everything she needed for the weekend getaway without exceeding the airline's weight limit.

7. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

8. Nagpunta ako sa may kusina para hanapin siya.

9. Biglaan ang pag-ulan kanina kaya ako ay nabasa nang husto.

10. Pinag-iingat ng mga awtoridad ang mga mamamayan laban sa mga salarin na gumagala sa paligid.

11. The patient's quality of life was affected by the physical and emotional toll of leukemia and its treatment.

12. Batang-bata ka pa at marami ka pang kailangang malaman at intindihin sa mundo.

13. Pinapakain ng pulotgata ang mga langgam sa aming bakuran.

14. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

15. Ang aming pamilya ay mahilig magsagwan sa karagatan tuwing Sabado.

16. Tsuper na rin ang mananagot niyan.

17. Nahantad ang mukha ni Ogor.

18. Nakatitig siya sa tatlo pa niyang kapatid.

19. Bumili si Ryan ng pantalon sa palengke.

20. They have been playing tennis since morning.

21. Nang magbago ang mga pangyayari at matanggap ko ang mga kaganapang hindi ko inaasahan, ang aking pagkabahala ay napawi.

22. Hang in there and don't lose hope - things will turn around soon.

23. Sa tuwing pinagmamalupitan ako, lumalalim ang poot at humahantong sa galit.

24. There were a lot of boxes to unpack after the move.

25. Ano ang ginugunita sa Thanksgiving Day?

26. Sumakay kami ng kotse at nagpunta ng mall.

27. Nakikita si Carlos Yulo bilang inspirasyon ng maraming kabataang Filipino.

28. Pinagsama ko ang pulotgata at gata ng niyog upang gumawa ng matamis na meryenda.

29. Mahirap hanapin ang katotohanan sa kaibuturan ng kaso.

30. Nagsusulat ako ng mga pangako sa aking mga minamahal sa mga espesyal na okasyon.

31. Hindi ito nasasaktan.

32. Hindi ako nakatulog sa eroplano.

33. It takes strength and courage to offer forgiveness, especially when the hurt is deep.

34. Isang binata ang napadaan at tinangkang kumain ng bunga ng puno.

35. Nag-aaral si Maya sa Unibersidad ng Pilipinas.

36. Agad na natuyo ang dugo hanggang sa naging abo ito at humalo sa lupa.

37. Kangina pa ako nakapila rito, a.

38. Doa dapat membantu seseorang untuk memperkuat keimanan dan menenangkan hati.

39. Ang kalangitan ay nagbabaga sa pulang liwanag ng dapithapon.

40. Medarbejdere kan blive tildelt forskellige arbejdstider, som natarbejde.

41. Marahil ay maulan bukas kaya't dapat magdala ng payong.

42. La seguridad en línea es importante para proteger la información personal y financiera.

43. The height of the basket and the court size varies depending on the age and skill level of the players.

44. The acquired assets included a portfolio of real estate properties.

45. Ang bata ay na-suway sa kanyang magulang nang hindi sumunod sa kautusan.

46. Lagi na lamang itong nag fe-facebook.

47. Napakainit ng panahon kanina at biglaan kaming nagpasyang mag-swimming.

48. Kung anong puno, siya ang bunga.

49. At ako'y namulat sa hubad na katotohanan.

50. Nakalimutan ko na ang pakiramdam ng hindi paghahanda sa agaw-buhay na pag-ibig.

Similar Words

Germany

Recent Searches

manysinundangfatalmauntogsharingmalawakcurtainslumakaspopulationsiranakagalawsineflaviowalanginteriormereuwisumaliotrashudyatsumasambarelativelyenergy-coalhikingmahiwaganggawingmatikmansidoipinagdiriwangkatagalansasamabinibilangsarongkwenta-kwentastartedulamibonhinding-hindikagyatkartonsang-ayonnatigilannakabaondecisionsmasamangmanonoodlipadsamakatwidkinakailangangpinyachoirmetodisktagapagpapasakitsapatlibrosanamandirigmangmagandaikinabubuhayarbejdersantosopgaver,naglabasiyangmedyosayawanimprovemahahaliktherebuwissilyatagakpulamahabateleponosapatoshaponsangkalannutrientsorderininspiredibinaonkanilalegislativefacemasklumakingpoolprimerossentencepondonagpapasasaginanglumayotagumpaylangostanaglabananestasyoninteractikawalongagricultoreshusayjeetmuchmagpalibreniligawanpagawainisisingittasamasaholpaparamiusingtatlongemphasizedkaklasekaliwangpanunuksouuwimakangitibumangonyourhimutokasalunahinmisaimbeskanyaabonapakagandangkahoypagdudugonakangangangpetnaibabakausapintopicjigssanto2001speechesmaayosmatamantinulak-tulakpahiramkasamahaneventosthesekahuluganrelongayongnag-alalapagkakatayogamitindividualsulatmagtipidtinataluntonisilangpinapatapospedengplaguednag-iisipkinsegradmaluwangamuyinatesabihinconectansankalayaanbagkus,hearmag-asawangproducts:kapalreviewersspongebobgagambaformasmovingvarietysaturdaybansangtomarpamilyahalagaamakanapagkakalutotutubuinpinangalanandanmarkadvancementsmappanghabambuhaymaghahandalumayasvariedadboracay