Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "free"

1. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

2. Don't be fooled by the marketing gimmick, there's no such thing as a free lunch.

3. Forgiveness is a gift we give ourselves, as it allows us to break free from the chains of resentment and anger.

4. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

5. He thought he was getting a free vacation, but I reminded him that there's no such thing as a free lunch.

6. I know they're offering free samples, but there's no such thing as a free lunch.

7. I learned early on that there's no such thing as a free lunch - everything comes with a cost.

8. May nagbigay sa amin ng biglaang free food sa opisina kanina.

9. Microscope lenses must be kept clean and free of debris to avoid distortion and other imaging problems.

10. Ok. Free ka ba after work? Favor lang sana please.

11. She reads books in her free time.

12. She was excited about the free trial, but I warned her that there's no such thing as a free lunch.

13. The ad might say "free," but there's no such thing as a free lunch in the business world.

14. The charitable organization provides free medical services to remote communities.

15. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

16. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

17. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

18. The seminar might be free, but there's no such thing as a free lunch - they'll probably try to sell you something at the end.

19. They offer interest-free credit for the first six months.

20. Trump's foreign policy approach included renegotiating international agreements, such as the North American Free Trade Agreement (NAFTA) and the Paris Agreement on climate change.

21. We might be getting a discount, but there's no such thing as a free lunch - we're still paying for it in some way.

Random Sentences

1. She learns new recipes from her grandmother.

2. Gumawa si Mario ng maliit na bola mula sa papel.

3. Kung hindi ka interesado, okay lang, pero sana pwede ba kita ligawan?

4. Mi sueño es ser un artista exitoso y reconocido. (My dream is to be a successful and recognized artist.)

5. Ang bayanihan ay nagpapakita ng diwa ng pagmamalasakit at pagbibigayan sa aming komunidad.

6. The level of sweetness can vary in different types of sugar and sweeteners.

7. Nagkaaksidente ang barko kaya hindi natuloy ang aming biyahe sa isla.

8. Bumangon ka nga jan! Saka paano ka nakapasok!

9. Kailangan ko umakyat sa room ko.

10. "Mahal kita," ani ng binata sa dalagang kanyang nililigawan.

11. Limitations can be perceived or real, and they can vary from person to person.

12. Nakatanggap kami ng masamang balita na ang aking kaibigan ay nawala at ito ay lubos naming ikinalulungkot.

13. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

14. El nacimiento puede ser un momento de reflexión y celebración, y puede marcar el comienzo de una nueva etapa en la vida de la familia.

15. Mahirap malaman kung ano ang nasa isip ng isang taong mailap.

16. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

17. Las serpientes son animales de sangre fría, lo que significa que dependen del ambiente para regular su temperatura corporal.

18. Oscilloscopes can be connected to a computer or network for data logging, remote control, and analysis.

19. Maaliwalas ang mukha ni Lola matapos siyang bisitahin.

20. Ang mga kundiman ay nagpapahayag ng kahalagahan ng pag-ibig at pagmamahal sa ating bayan.

21. Dahil sa biglaang trapik, na-late ako sa meeting ko kanina.

22. Ininom ni Henry ang kape sa kusina.

23. Oo. Gusto ko na lang sana talaga makauwi. sagot ko.

24. How I wonder what you are.

25. Wag mo naman hayaang mawala siya sakin.

26. Minsan, nagulat ang pamilya sa pagdating ni Roque dahil may kasama itong lalaking may sugat.

27. I am not reading a book at this time.

28. Natutuwa ako sa balitang iyan mahal ko.

29. Los héroes son capaces de tomar decisiones difíciles y hacer sacrificios personales en beneficio de los demás.

30. Naniniwala ang mga Katoliko na ang mga dasal para sa mga kaluluwa sa purgatoryo ay makakatulong sa kanilang kaligtasan.

31. Ang pagiging aware at vigilant sa paligid ay mahalaga upang maiwasan ang pagkalat ng droga sa lipunan.

32. Gusto ko pang mag-order ng kanin.

33. Ikinagagalak naming ipahayag na nagkaroon ng positibong pagbabago sa ating komunidad.

34. Nag-aalala ako para sa kalusugan ko, datapwat hindi pa ako handa para sa check-up.

35. Natayo ang bahay noong 1980.

36. Nahuli ang magnanakaw ng mga sibilyan at iniharap ito sa mga pulis.

37. Ang kanilang pagmamahalan ay animo'y walang hangganan, kahit sa anong pagsubok na dumaan.

38. May klase ako sa Tagalog tuwing Lunes.

39. Quiero tener éxito en mi carrera y alcanzar mis metas profesionales. (I want to succeed in my career and achieve my professional goals.)

40. Cultivar maíz puede ser un proceso emocionante y gratificante, con una buena planificación y cuidado, se puede obtener una cosecha abundante

41. Anung email address mo?

42. Los héroes pueden ser tanto figuras históricas como personas comunes que realizan actos heroicos en su vida cotidiana.

43. Marurusing ngunit mapuputi.

44. Emphasis is often used in advertising and marketing to draw attention to products or services.

45. Nagbigay ng kanyang opinyon ang eksperto ukol kay President Bongbong Marcos

46. Ano ang kulay ng libro ng kaklase mo?

47. Si Ogor ang kanyang natingala.

48. Umiiyak ang kanyang mga magulang ngunit alam nilang wala na silang magawa para sa bata.

49. May kakaibang naramdaman ang prinsesa sa makisig na binata na iyon.

50. Sa sobrang pagod, nagawa niyang paglimot sa mga pangyayari ng nakaraang araw.

Similar Words

freedomsFreelancing:freelancer

Recent Searches

freeniyanikinalulungkotniyogtagatelebisyongalakpalamutiamazonmississippiriegalapisnakangitingtagtuyotinterpretinghalttutusinkayapinagtabuyannaghuhumindigpelikulaaraw-arawhabilidadeshiyamaibaliknavigationnagkikitalonghalamanwritinginternalorenaticketkaarawan,hangaringpalanghitsuraninanaispesoslisteningtransportmidlertrabahomoviesstep-by-stephinapetdraft:bagamatmarahasprincipalesgayunmanlitopangulobooksaidlimatiklibrenapakahabatog,daangpag-uugalipamamasyalbundoknagkakatipun-tiponlaganapnagkitaasiaticfullfalleditduondowndoonkumatoknagtuturoditocoathahatolcashlutobusybaulbatibangbaitpagkaimpaktobabaalin19901982187611pmyunwowlearningunocheftaosonouenyenunnewbirthdaypangangailanganimproveleokaypakanta-kantanaiisipkanjobisahishimguroactorfridaypamilyahalamangklasepagkamanghagustomakingnagtalagainterioripinauutangmostnapabalikwasnaglabagabekundimanpitongayondapatgiraypagbatibio-gas-developingkapamilyasapatostawananlabanpagsigawprinsesangganangglobalreviewersnagbabasanangingitngitinspiredpanatagbanyonatatanawagam-agamkarangalanfiasensibleelevatorkamiusedamasobaonnapakaselosodistancenabahalaperasugatangmag-ibasiempremasaktanworkshopmanykaagadgennaaddkungtumikiminfluentialgradpawismatandaleadincomeworkingbituinsiranakabilisupremetaga-lupangnamasyalhouseholdsbolapoorermasaganangihahatidschoolsmangingisdangmatindinilalangtabi