Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "free"

1. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

2. Don't be fooled by the marketing gimmick, there's no such thing as a free lunch.

3. Forgiveness is a gift we give ourselves, as it allows us to break free from the chains of resentment and anger.

4. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

5. He thought he was getting a free vacation, but I reminded him that there's no such thing as a free lunch.

6. I know they're offering free samples, but there's no such thing as a free lunch.

7. I learned early on that there's no such thing as a free lunch - everything comes with a cost.

8. May nagbigay sa amin ng biglaang free food sa opisina kanina.

9. Microscope lenses must be kept clean and free of debris to avoid distortion and other imaging problems.

10. Ok. Free ka ba after work? Favor lang sana please.

11. She reads books in her free time.

12. She was excited about the free trial, but I warned her that there's no such thing as a free lunch.

13. The ad might say "free," but there's no such thing as a free lunch in the business world.

14. The charitable organization provides free medical services to remote communities.

15. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

16. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

17. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

18. The seminar might be free, but there's no such thing as a free lunch - they'll probably try to sell you something at the end.

19. They offer interest-free credit for the first six months.

20. Trump's foreign policy approach included renegotiating international agreements, such as the North American Free Trade Agreement (NAFTA) and the Paris Agreement on climate change.

21. We might be getting a discount, but there's no such thing as a free lunch - we're still paying for it in some way.

Random Sentences

1. Mahilig si Tatay manood ng laro kung saan ang gamit ay bola.

2. Tweets are limited to 280 characters, promoting concise and direct communication.

3. Madalas na naglulusak sa dumi ang mga bakuran.

4. Ang sugal ay naglalabas ng mga salarin na nagpapayaman sa pamamagitan ng pag-aabuso sa mga manlalaro.

5. Lumitaw ang bungang-araw niya sa likod at leeg.

6. Baka roon matutong matakot iyan at magsabi ng totoo.

7. There's no place like home.

8. Mahigit sa pitong libo ang isla sa Pilipinas.

9. Allen "The Answer" Iverson was a lightning-quick guard known for his scoring ability and crossover dribble.

10. The team won a series of games, securing their spot in the playoffs.

11. Natawa ako sa maraming eksena ng dula.

12. A couple of dogs were barking in the distance.

13. Sa bata nakatingin ang pulis na wari'y nag-iisip ng dapat gawin.

14. Morning.. sabi niya na halos parang ang hina niya.

15. Nagdala siya ng isang bigkis ng kahoy.

16. The Lakers have retired numerous jersey numbers in honor of their legendary players, including numbers 8 and 24, worn by Kobe Bryant.

17. Nakaramdam ako ng sakit kaya hinugot ko ang aking kamay upang pumigil.

18. Ang pagpili ng lugar ng kasal ay importante upang masigurong magiging maganda ang setting.

19. La labradora de mi colega es muy sociable y siempre se lleva bien con otros perros.

20. El sismo produjo una gran destrucción en la ciudad y causó muchas muertes.

21. Ikinuwento niya ang nangyari kay Aling Pising.

22.

23. Ayon sa albularyo, may nakabati raw sa sanggol kaya siya nagkasakit.

24. Pagkatapos ng magandang ani, ang aming hardin ay hitik sa sariwang gulay at prutas.

25. Muchas escuelas ofrecen clases de música y hay numerosas instituciones educativas especializadas en música, como conservatorios y escuelas de música

26. Asegúrate de que el área esté libre de maleza y que el suelo sea bien drenado

27. Mababa ang marka niya sa pagsusulit dahil hindi siya nakapag-aral.

28.

29. Pagkagising ni Leah ay agad na itong naghilamos ng kanyang mukha.

30. Mula noong nakilala kita, hindi ko maalis sa isip ko na crush kita.

31. Forgiveness can be a gradual process that involves acknowledging the pain, working through it, and eventually finding peace within ourselves.

32. Ngumiti lang sya, I know everything, Reah Rodriguez.

33. Ang mga bayani ay nagbibigay ng pag-asa at magandang kinabukasan para sa mga susunod na henerasyon ng mga Pilipino.

34. Pero pag harap ko, para akong nanigas sa kinatatayuan ko.

35. Has she written the report yet?

36. Kumaen ka na ba? tanong niya sa akin.

37. La physique est une branche importante de la science.

38. May mga taong naniniwala na ang digmaan ay hindi ang solusyon sa mga suliranin ng mundo.

39. Omelettes are a popular choice for those following a low-carb or high-protein diet.

40. Mahalaga ang papel ng edukasyon sa pagpapalawig ng kaalaman at oportunidad para sa sektor ng anak-pawis.

41. Mabait na mabait ang nanay niya.

42. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

43. Naglaro sina Paul ng basketball.

44. He drives a car to work.

45. It may dull our imagination and intelligence.

46. La alimentación saludable debe incluir una variedad de proteínas, carbohidratos y grasas saludables.

47. He has been practicing the guitar for three hours.

48. Natagpuan ko ang susi ko sa dakong huli ng aking bulsa.

49. Scientific inquiry is essential to our understanding of the natural world and the laws that govern it.

50. Money can be earned through various means, such as working, investing, and entrepreneurship.

Similar Words

freedomsFreelancing:freelancer

Recent Searches

freecomunicanmagpahinganakainmadurasnalugodmahigitmariaespecializadassabadmagbigaypinagkaloobansignalfuncionaritinalagangmalabokumalasmag-iikasiyambagamatcabletekstpulisitsurapatrickpag-alagatangansabipagka-diwataincitamenterprofessionaltag-ulansino-sinoginawangpaanominsanhappierihandamakapasanaawakaniyaibinigaysmokingriyanbeforekarneniyakaawa-awangwonderpasalamatanunitedkelanchangedeleksyonbagyongambagnilalanglabingtunayearnnalalabiharapanstarted:kamimatatalimpapasafonospusangnapakalungkotknowlabantumingalasumasakitkomunidadsikatnakabanggapadernagpupuntapupuntahanbahay-bahayugatsayoskabemag-ibabuung-buomagpagalingnapilingresultanapadaanpinag-aralannapakahabangakastilakaninalumabasibinalitanguseoktubreknowledgeunabaseddreammaisplatformspiniliresortgoodrepublicanmailapreynamay-bahaypilitnaintindihanmaicopag-aaralmainitguhitlumangoybagkuspageantnabalotskyldes,naninirahannakikiamataposlolamotornai-dialpamanbinilingnagitlananlalamigbedsidekagandapeoplemedikalnapapadaannapakagandamaubossaturdaymealdrinktillamangamoymagtagokalankandidatoitotablenag-iyakannag-ugatpakiramdamrecordedtalinoduonopomawawaladiinnaiseyaitemsgeneratepinakainbibigyanseenpreskokasaganaannapangitihimigsiembrapalayobutchbahayamendmentshamaksetyembreamingiconoperativosanonapabuntong-hiningalumayounobusyangnagdaraanpumapasokipinalitchadmakingpanatilihinlamang-lupaaralnagkikitakotsengallbethnag-iisiphiligtanong