Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "libre"

1. Asegúrate de que el área esté libre de maleza y que el suelo sea bien drenado

2. En invierno, las actividades al aire libre incluyen deportes de invierno como el esquí y el snowboard.

3. En mi tiempo libre, aprendo idiomas como pasatiempo y me encanta explorar nuevas culturas.

4. Kailan ka libre para sa pulong?

5. Kailan libre si Carol sa Sabado?

6. Libre ba si Carol sa Martes ng gabi?

7. Libre ba si Renato sa Huwebes ng gabi?

8. Libre si Clara sa Sabado ng hapon.

9. Los powerbanks también son útiles para actividades al aire libre, como acampar o hacer senderismo, donde no hay acceso a la electricidad.

10. Mabait siya at nanggagamot siya nang libre.

11. Me encanta pasar tiempo al aire libre durante las vacaciones de primavera.

Random Sentences

1. Tara na nga Hon! Mga baliw ata yan eh!

2. Hun er ikke kun smuk, men også en fascinerende dame. (She is not only beautiful but also a fascinating lady.)

3. Det er vigtigt at huske, at helte også er mennesker med fejl og mangler.

4. Limitations can be a result of fear or lack of confidence.

5. The pretty lady walking down the street caught my attention.

6. The depth of grief felt after losing a loved one is immeasurable.

7. You reap what you sow.

8. La paciencia es una virtud que nos ayuda a ser mejores personas.

9. Naglalakad siya sa parke araw-araw.

10. I am not working on a project for work currently.

11. Buti naman. Ayoko mahawaan ng kuto eh.

12. May nakita akong matandang nag-aalok ng pulotgata sa palengke.

13. The team's performance was absolutely outstanding.

14. Umikot ka sa Quezon Memorial Circle.

15. Chester A. Arthur, the twenty-first president of the United States, served from 1881 to 1885 and signed the Pendleton Civil Service Reform Act.

16. Hinahayaan kong lumabas ang aking poot upang maipahayag ang aking saloobin at damdamin.

17. La science est la clé de nombreuses découvertes et avancées technologiques.

18. Makinig ka na lang.

19. The chef created a series of dishes, showcasing different flavors and textures.

20. Kailan at saan po kayo ipinanganak?

21. May himig pangungutya ang tinig ng pulis.

22. The internet has also made it easier for people to access and share harmful content, such as hate speech and extremist ideologies

23. At forfølge vores drømme kan kræve mod og beslutsomhed.

24. Sa edad na 35, si Rizal ay pinatay sa pamamagitan ng pagsasalang ng baril sa Luneta Park noong Disyembre 30, 1896.

25. Nagtapos siya ng kolehiyo noong 1982.

26. Makikita mo sa google ang sagot.

27. Donald Trump is a prominent American businessman and politician.

28. Mi sueño es tener éxito en mi pasión por la moda y el diseño. (My dream is to succeed in my passion for fashion and design.)

29. Bien que le jeu en ligne puisse être pratique, il est également important de prendre en compte les risques impliqués, tels que la fraude et le vol d'identité.

30. Patients may need to follow a post-hospitalization care plan, which may include medications, rehabilitation, or lifestyle changes.

31. Aku merindukanmu, sayang. (I miss you, dear.)

32. Nagtatrabaho ako sa Student Center.

33. Es freut mich, Sie kennenzulernen. - Nice to meet you.

34. Bakit? Dahil ba mahahawa ako sa sakit mo? concern ba sya?

35. Kilala si Marites bilang isang tsismosa sa kanilang baranggay.

36. Sa bawat pagkakataon na nabibigo ako, naglalabas ako ng malalim na himutok upang maibsan ang aking kalungkutan.

37. Ang lahat ng problema.

38. May problema ba? tanong niya.

39. Tesla has faced challenges and controversies, including production delays, quality control issues, and controversies surrounding its CEO, Elon Musk.

40. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

41. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

42. Ngunit isang sugatang pirata ang nagkaroon pa ng pagkakataong mamaril bago ito binawian ng buhay.

43. Nous avons opté pour une cérémonie de mariage intime.

44. Nakabili na sila ng bagong bahay.

45. It's so loud in here - the rain is coming down so hard it's like it's raining cats and dogs on the roof.

46. Mens nogle mennesker kan tjene penge ved at gamble, er det en risikabel investering og kan ikke betragtes som en pålidelig indkomstkilde.

47. Some people have a sweet tooth and prefer sweet flavors over others.

48. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

49. Ang bayanihan ay nagbibigay inspirasyon sa aming mga kabataan na maging aktibo at maging bahagi ng komunidad.

50. Bibili rin siya ng garbansos.

Similar Words

ililibreLibrengmagpalibre

Recent Searches

librejuicepaginiwanjuegosestablishedprinsipengenforcingtiketsertulalasandokwagkinakailangangusgusingnaroonmariasambitstartnakakapasokkombinationinitabalanegroskinaumagahannoongtaga-lupangrawcomplexdisappointedgustongsetmahusaymakahihigitbeforekalahumalakhakmakasarilingparticipatinghigantecurrentnagsusulatnaglabadathroatkuwintassulingankumakantapagtiisankinauupuandogsarbularyochoipopulationsentimosbeybladepamamaganakaraanginiunatdiscipliner,itimkabibipaglisanpag-irrigatenaapektuhantaun-taonpaananumalisisilangsumasayawnakakamanghaeskwelahansasakyannaiwanpitakaimikginangharapanressourcernenaghilamosginooaltkinukuyombakurandinnalagutaniilanulandiedcreatividadplantarnogensindemartapolonamumulaangkankasyachoicelaroligaanosisikattinutopsubalitpagkalitoilanhagdananpaghihingalorinriyandahiliniirogpagdiriwanglargemunangpagkaganda-gandangumitinagginglumagopinamumunuanformpiyanomagkaibanalalarohamakmahiyanakuhangnagbanggaanricahiningalabingtodasdivisorialunestahimikbilanginpaldakagandahannamataysariwaparoroonaoutlinepaanopinalakingmemorialmalagothanksgivingturismoultimatelybunutanhinukaykabilangbarosiponpumatolnakalilipasnapabayaanmaipapamanakinuskosclassmateipinagdiriwangnakisakaypinagawadisenyocoaching:makatawarabeeroplanogumisingmatakawisa-isakinagabihanhimutoknakaupointeragerernagbabakasyonnapakahanganicekagatolinyojunioginoongtatlokatibayangprogramsgamestaousaentrancesigurohinanakitnunadvancestofilipinalargopagkabuhaymaistorbosamakatuwidbilipagawainkusina