Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "inspire"

1. Dedicated teachers inspire and empower their students to reach their full potential.

2. Einstein's legacy continues to inspire and influence scientific research today.

3. Einstein's legacy continues to inspire scientists and thinkers around the world.

4. Grande's dedication to her artistry and philanthropy continues to inspire fans worldwide.

5. His films, teachings, and philosophy continue to inspire and guide martial artists of all styles

6. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

7. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

8. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

9. Limitations can be challenging, but they can also inspire creativity and innovation.

10. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

11. Nationalism can inspire a sense of pride and patriotism in one's country.

Random Sentences

1. Sa pamamagitan ng kundiman, naipapahayag ang mga hindi nasasabi ngunit nararamdaman ng mga pusong sugatan.

2. Nag-iyakan ang dalawang batang sina Maria at Jose.

3. Sa droga, walang nagwawagi kundi ang tao mismo.

4. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

5. Akin na cellphone mo. paguutos nya.

6. He does not play video games all day.

7. Tengo fiebre. (I have a fever.)

8. Gawa ang palda sa bansang Hapon.

9.

10. Gaano katagal ho kung maglalakad ako?

11. Gumagalaw-galaw ang sabog na labi ni Ogor.

12. Sa ganang iyo, dapat bang palakasin pa ang kampanya laban sa fake news?

13. Coffee shops and cafes have become popular gathering places for people to socialize and work.

14. Cheating can have devastating consequences on a relationship, causing trust issues and emotional pain.

15. Ano ang malapit sa eskuwelahan?

16. Nakakuha ako ng sagot sa brainly.

17. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

18. Ang aming angkan ay may natatanging kultura at mga paniniwala.

19. The charitable donation made it possible to build a new library in the village.

20. Bilang paglilinaw, hindi mandatory ang pagsali sa aktibidad na ito.

21. Sa facebook kami nagkakilala.

22. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

23. Danmark eksporterer også mange forskellige typer af maskiner og udstyr.

24. Gusto naming makita uli si Baby Janna eh. si Maico.

25. Omelettes are a popular choice for those following a low-carb or high-protein diet.

26. Nood tayong movie. maya-maya eh sabi niya.

27. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

28. Hinugot niya ang susi sa kanyang bulsa at binuksan ang pinto.

29.

30. Nangangamba ako sa pagdidilim ng aking paningin dahil sa pagkakaroon ko ng mataas na grado.

31. Ganid ang tawag sa mga taong walang inatupag kundi ang makapanglamang sa kapwa.

32. Cuando las plantas tienen al menos dos hojas, trasplántalas al lugar definitivo

33. Ang magnanakaw na kumaripas ng takbo ay nahuli rin sa dulo ng kalsada.

34. La tos puede ser un síntoma de neumonía.

35. Ano ang pinabili niya sa nanay niya?

36. Lazada has a reputation for offering competitive prices and discounts.

37. Las personas pobres a menudo viven en condiciones precarias y carecen de seguridad económica.

38. Yes Sir! natatawa pa ako saka ko binaba yung tawag.

39. Laging kinatatakutan si Kablan sa pagiging usurero sa Palawan, ang pating naman ay lagi ring kinasisindakan sa kabangisan.

40. Mahalagang magkaroon ng emergency fund upang maiwasan ang pagkakaroon ng utang sa panahon ng krisis o emergency.

41. Limitations can be physical disabilities, such as hearing or vision loss, or mental health conditions, such as anxiety or depression.

42. Las redes sociales también son un medio para hacer negocios y promocionar productos.

43. By refusing to compromise, she ended up burning bridges with her business partner.

44. Anong klaseng karne ang ginamit mo?

45.

46. Eksporterer Danmark mere end det importerer?

47. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

48. She has started a new job.

49. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

50. Ang aking teacher ay hindi muna nagturo ngayong araw.

Similar Words

inspired

Recent Searches

maatimsakiminspireprobinsyamataaasgjortcashbumigaysetyembrekahilinganmarangyangsacrificenasancapacidadnoonnaglabananltogantingsigetradepangitsawaaniyaniligawannamnaminpogipasigawmemberspriestpanonanlalambotresulteverythinganakgearmagdasukataccederresortsuccessyepdeteriorateinantokcareagadbaullarrybipolarsaringmaaringmapuputirelospeechesbilhinnagbungaagamiratugonsahodeksenaioslivekilointerpretingspendingoncerefersbelievednotagilityugathumalikpageaspirationmillionsclientsnabagalanroquerawqualityaminglockdownendseensecarsecheckscandidateipinashapingmakeprogresswhileremotebitbitwhetherrepresentativeulinginitilinglasingninyoipinadakipmagtigilpinagkanyaniyasumuotbakatilabahayanimakawalapootmaibabalikkamamagbubukidkananlubosreachtirantedahilkahongnatatakotipanlinisgulatpinipilitincidencemahabangambisyosangakinobra-maestratelecomunicacionesnapaiyakkasimakasarilingdividesnakaupoe-explainprutasfigurascoughingadvancementsmadungisnapagsinabingtotoonovemberpresleypatawarinnaka-smirksalatnawalangnakakatabamatagumpaymatabapaninigasletterdiapererlindatinaasanpaga-alalakalayaanpagkuwanagsunurannagmakaawamang-aawitnakakagalingpagkakalutomarketplacespronounmakatatlounti-untiopgaver,revolutioneretinasikasohumiwalaynaguguluhanaanhinnapakagagandaubodna-fundendvidereescuelaspagmasdanobservation,iyamotpinapakingganhinalungkatpaalamkagandahanbayadtiyakcaracterizakinakainnagpakitapunongkahoymagbabakasyonnakapagreklamopagka-maktolpunung-puno