Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "lagaslas"

1. Narinig ko ang lagaslas ng tubig mula sa shower.

Random Sentences

1. Sumungaw ang payat na mukha ng kanyang asawa.

2. Wala kang kuto noh? nabigla ako ng magsalita sya.

3. Nangangaral na naman.

4. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

5. The billionaire was known for his charitable donations to hospitals and schools.

6. Sabi mo eh! Sige balik na ako dun.

7. May bumisita umano sa bahay nila kagabi ngunit hindi nila nakita kung sino.

8. Ang mga bayani ay mga taong nagsakripisyo para sa kalayaan at kabutihan ng bayan.

9. Las plantas son seres vivos que realizan la fotosíntesis para obtener energía.

10. Nagsisimula akong mag-exercise sa hatinggabi para sa aking kalusugan.

11. Narinig ni Ana ang boses ni Noel.

12. Nationalism has been a powerful force in shaping the modern world, particularly in the aftermath of colonialism.

13. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

14. Akin na kamay mo.

15. Kinuha ko yung CP niya sa bedside table.

16. Some people view money as a measure of success and achievement, while others prioritize other values.

17. Doon itinapon at ibinaon ni Mariang Maganda ang mahiwagang kamay ng kanyang tinawag na irog.

18. Il est tard, je devrais aller me coucher.

19. Imulat ang isipan sa mga kulay ng buhay.

20. Nagkaaksidente ang barko kaya hindi natuloy ang aming biyahe sa isla.

21. Sa simula ng kabanata, ipinakilala ang bagong karakter na magiging pangunahing tauhan.

22. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

23. I can't keep it a secret any longer, I'm going to spill the beans.

24. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

25. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

26. Medarbejdere kan blive tildelt forskellige arbejdstider, som natarbejde.

27. Los niños son propensos a sufrir de tos debido a infecciones respiratorias comunes, como el resfriado común y la gripe.

28.

29. La boda de mi amigo fue una celebración inolvidable.

30. Le marché boursier peut être un moyen de faire fructifier son argent.

31. Ang parusang angkop sa suwail na anak ay iginawad.

32. Antioxidant-rich foods, such as berries and leafy greens, can help prevent chronic diseases.

33. Pinabulaanang muli ito ni Paniki.

34. The singer on stage was a beautiful lady with an incredible voice.

35. Sa Chinese New Year, ang mga pamilya ay nagtitipon upang magsalu-salo at magbigayan ng mga regalo.

36. Es importante leer las etiquetas de los alimentos para entender los ingredientes y la información nutricional.

37. Sa pamamagitan ng kundiman, naipapahayag ang mga hindi nasasabi ngunit nararamdaman ng mga pusong sugatan.

38. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

39. Ang malambot na lilim ng ulap ay nagbigay ng kakaibang kulay sa silong ng buwan.

40. Iyong pakakatandaan na ikaw lamang ang aking iniibig.

41. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

42. Magkano ang isang kilo ng mangga?

43. Las redes sociales tienen un impacto en la cultura y la sociedad en general.

44. I don't think we've met before. May I know your name?

45. Malakas ang hangin kung may bagyo.

46. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

47. Alt i alt er den danske økonomi kendt for sin høje grad af velstand og velfærd, og dette skyldes en kombination af markedsøkonomi og offentlig regulering, eksport, offentlig velfærd og økologisk bæredygtighed

48. Napangiti siyang muli.

49. Magalang na nagpakumbaba si John nang makita ang matanda sa kalsada at tinulungan ito.

50. Mag-ingat sa aso.

Recent Searches

taba1982atecaseslagaslaspamahalaanbridepasahenaglokoyangothert-shirtnakakadalawkarnabalpagkalitolefthangincapacidadalamidcomunicarsenaglahonapilieventsnagsisigawgisingfulfillingdahanbisikletanagpatuloymahinangmenosbulaisubotilgangtumunogmaihaharapsensiblelibrenagkakasyaevolvereallytsaaexhaustedkumapitpaysinundangkilosulatnagliliwanagsakenoperativoshaponlumusobpracticadosynclapitannagsisihanthirdlibagmakakawawaisamaclientsnamumulotpinaladitemspandidirilarrymaghintaymag-asawangkara-karakaumibignilulonnagdabogsampungrepresentedcontrolabranchesnababalotpagdamiumilingtechnologiesuugod-ugodtoolsimplengnalulungkotmulti-billionmagturonamingnalalabiculturenai-dialpawiinkapainaninaririnigtextbagkusregularmenteinaabutanmalabomesangdonenagpamasahetonettekelanemocionantepingganmanakboatensyonaffectmaligoeasypagtangotekstpagkikitagospeltabasmagagandadancepinakamahalagangbahasuriinkalayaanmagtrabahoinspirasyon10throlepagbabagopinisilbumabalotnaminlarawananywheresigsimuleringersusundotrasciendegreatlynasakaaya-ayangpinapalokaharianareasmapagkalingapetroleumproblemahigitmakipag-barkadakungstreetlupanasanfacultyprovidedhealthasiapigingkasiyahangmagpahingabeyondamericaincitamentersinasabihinipan-hipanshowsapologeticotrasmakuhaalemeansmaipapautangrailgiyeratravelerestatekusinero1970saffiliateiligtasairportpinabayaanactualidadbusinessesmaliliitiba-ibangourlapisstarredrimasbyggetnakapasamallpaglakipinag-usapannakatuoninatakehumanomamanhikanpyestakinatatakutan