Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

27 sentences found for "each"

1. Before a performance, actors often say "break a leg" to each other for good luck.

2. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

3. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

4. Football is played with two teams of 11 players each, including one goalkeeper.

5. Forgiveness is a personal journey that varies for each individual; there is no set timeline or right way to forgive.

6. He bought a series of books by his favorite author, eagerly reading each one.

7. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

8. Hockey is played with two teams of six players each, with one player designated as the goaltender.

9. Holy Week is observed by Christians around the world, with various traditions and customs associated with each day.

10. It's crucial to pay off your credit card balance in full each month to avoid interest charges.

11. Presidential elections are held in November and involve a system of electoral votes, where each state is allotted a certain number of votes based on population

12. Scientific experiments have shown that plants can respond to stimuli and communicate with each other.

13. The basketball court is divided into two halves, with each team playing offense and defense alternately.

14. The bride and groom usually exchange vows and make promises to each other during the ceremony.

15. The computer programmer wrote a series of codes, debugging and refining each one until the project was complete.

16. The fashion designer showcased a series of collections, each with its own unique theme and style.

17. The football field is divided into two halves, with each team playing offense and defense alternately.

18. The game is played with two teams of five players each.

19. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

20. The invention of the telephone and the internet has revolutionized the way people communicate with each other

21. The members of the knitting club are all so kind and supportive of each other. Birds of the same feather flock together.

22. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

23. The United States also has a system of governors, who are elected to lead each individual state

24. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

25. There are different types of scissors, such as sewing scissors, kitchen scissors, and craft scissors, each designed for specific purposes.

26. Twitter allows users to send direct messages (DMs) to each other for private conversations.

27. Ultimately, the concept of God is deeply personal and subjective, with each person's beliefs and experiences shaping their understanding of the divine.

Random Sentences

1. Ang lugar na iyon ay tila isinumpa.

2. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

3. Marurusing ngunit mapuputi.

4. Ano pa ba ang ibinubulong mo?

5. Ang pag-asa ay maaaring magdulot ng positibong pagbabago sa buhay ng mga tao.

6. Cheating can have devastating consequences on a relationship, causing trust issues and emotional pain.

7. High blood pressure can often be managed with a combination of medication and lifestyle changes.

8. Dahil sa magandang kwento, hindi ko namalayang nahuhumaling na pala ako sa pagbabasa ng nobela.

9. Ang buhawi ay maaaring magdulot ng matinding pagkasira sa kagubatan at kapaligiran dahil sa malakas na hangin at pag-ulan.

10. Pagkatapos nila mag-usap at pagkapasok ni Helena sa kanyang kwarto ay nilapitan ni Haring Bernardo ang binata at kinausap ito

11. The store was closed, and therefore we had to come back later.

12. Nagbiyahe ako sa Mindanao noong isang taon.

13. At leve i overensstemmelse med vores personlige overbevisninger og værdier kan styrke vores samvittighed.

14. Makikiraan po!

15. Frustration can be a sign that we need to reevaluate our approach or seek alternative solutions.

16. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

17. Halos hindi niya narinig ang halingling ni Ogor.

18. Forgiveness is a personal journey that varies for each individual; there is no set timeline or right way to forgive.

19. Las heridas punzantes, como las causadas por clavos o agujas, pueden ser peligrosas debido al riesgo de infección.

20. Sino-sino ang mga nagsibili ng mga libro?

21. Araw araw niyang dinadasal ito.

22. Magdamag kong naiwang bukas ang ilaw.

23. O sige na, sige na! Tumahan ka na lang!

24. Sa mga nakalipas na taon, yumabong ang mga organisasyon na tumutulong sa mga nangangailangan.

25. OMG. Makalaglag-panty si Kuya!!

26. It takes strength and courage to offer forgiveness, especially when the hurt is deep.

27. Sa isang malayong pook sa Pilipinas nakatira ang mag-asawang sina Mang Kandoy at Aling Pising.

28. Det er vigtigt at respektere og anerkende transkønnede personers kønsidentitet og bruge deres præfererede pronominer og navne.

29. La realidad es que las cosas no siempre salen como uno espera.

30. Kahit paano'y may alaala pa rin siya sa atin.

31. May dalawang kotse sina Dolly at Joe.

32. We have finished our shopping.

33. May luha siya sa mata ngunit may galak siyang nadama.

34. Ang paglapastangan sa dignidad ng kapwa ay hindi dapat maging bahagi ng ating kultura.

35. The United States has a system of federalism, where power is divided between the national government and the individual states

36. Pagkuwa'y bigla na lamang nitong kakayurin ng hintuturo ang balat sa kanyang batok.

37. Tesla has a strong and passionate community of supporters and customers, known as "Tesla enthusiasts" or "Teslaites."

38. Ang tagumpay ng kanilang proyekto ay lubos na ikinagagalak ng kanilang grupo.

39. Hindi niya namalayan na tatlong oras na siyang tulala sa harap ng kanyang computer.

40. Manahimik ka na nga, tara ng umuwi! Andyan na driver ko!

41. Tumaba sila ng tumaba hanggang sa tuwing maliligo kahit na pa tatlong tao lang sa sapa ay umaapaw agad tubig.

42. Dadalaw ako kay Lola Sela bukas.

43. Les patients peuvent bénéficier de programmes de réadaptation pendant leur hospitalisation.

44. Mabuti pa makatayo na at makapaghilamos na.

45. L'éducation est un élément clé pour le développement personnel et professionnel.

46. Minabuti nilang ilihim nila ito sa kanilang anak.

47. Lumabas siya upang magmuni-muni sa oras ng takipsilim.

48. Pagkakataon na ni Ogor upang sumahod.

49. Makikita mo sa google ang sagot.

50. Mayroong kapatid na babae si Rosa.

Similar Words

beachteacherreachteachfar-reachingteachingsreaching

Recent Searches

continuedeachnariningcommunicateannamereventaimpitformpetercrazysafemichaelbinabadarkfascinatingferrerschoolrolledhoweverbulakartonisinawakgenelistahankalakingzoommanualpatungongincludepoliticsfuryshortleukemiavampirestryghedsoreroonkwebangkangkongnangingitianparatingpagiisipboyetbinigyangoverallrevisesparkpocahenrysubjectsumarapconvertidaschoicecornersnagkwentopagsalakayloobtumabigulangpasyamatangtumigillaganaptahananfreelancertablenakitangbeingsinisipanghihiyangaraw-badingmahahabalutuinikinamataytugonlagiwithoutgloriahinabolbalancesmakemedya-agwakadalagahangmagtatampodinanasbitbitsettingstyrerbinangganapagtantomemoryconclusionsequesurepadabogprogresslamesastartedmagbabalatatawagumigibkumbinsihinhalipissueskagalakanbutikiindustriyapagbatilaki-lakihumabiamendmentsbinatimag-asawadekorasyondropshipping,namulaklakinterestscosechar,youngtinayhagdananbibisitababasahinkinalilibinganalapaapdurianpilitnobelamagta-trabahonapilikulangtiniklingumigtadnapakamanuksopakibigyansadyangnetopinagmamasdanpakinabangankitangipinapamagatperogoalvaccineshayopbotoonlineattacktandacriticspeoplepahahanapmagpahabakabarkadamahinahongmedikalmangahaspshbahay-bahayitemssaan-saanbukodultimatelykunwakumidlatutusanlalakadinataketulogideatooldesisyonanmaabutanpistatoyslever,pamilihankalaronapasubsobsnobkayongnakapikitsulyappanitikan,ibilipaghugosmemonapakahusayjackycapacidadespaguutoscarriedakinhinilatiket