Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

27 sentences found for "each"

1. Before a performance, actors often say "break a leg" to each other for good luck.

2. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

3. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

4. Football is played with two teams of 11 players each, including one goalkeeper.

5. Forgiveness is a personal journey that varies for each individual; there is no set timeline or right way to forgive.

6. He bought a series of books by his favorite author, eagerly reading each one.

7. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

8. Hockey is played with two teams of six players each, with one player designated as the goaltender.

9. Holy Week is observed by Christians around the world, with various traditions and customs associated with each day.

10. It's crucial to pay off your credit card balance in full each month to avoid interest charges.

11. Presidential elections are held in November and involve a system of electoral votes, where each state is allotted a certain number of votes based on population

12. Scientific experiments have shown that plants can respond to stimuli and communicate with each other.

13. The basketball court is divided into two halves, with each team playing offense and defense alternately.

14. The bride and groom usually exchange vows and make promises to each other during the ceremony.

15. The computer programmer wrote a series of codes, debugging and refining each one until the project was complete.

16. The fashion designer showcased a series of collections, each with its own unique theme and style.

17. The football field is divided into two halves, with each team playing offense and defense alternately.

18. The game is played with two teams of five players each.

19. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

20. The invention of the telephone and the internet has revolutionized the way people communicate with each other

21. The members of the knitting club are all so kind and supportive of each other. Birds of the same feather flock together.

22. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

23. The United States also has a system of governors, who are elected to lead each individual state

24. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

25. There are different types of scissors, such as sewing scissors, kitchen scissors, and craft scissors, each designed for specific purposes.

26. Twitter allows users to send direct messages (DMs) to each other for private conversations.

27. Ultimately, the concept of God is deeply personal and subjective, with each person's beliefs and experiences shaping their understanding of the divine.

Random Sentences

1. Tila bakal na kumakapit ang mga kamay.

2. Ano ang ginawa ni Tess noong Abril?

3. Mauupo na lamang siya sa kanyang balde.

4. Pinuri ni Pangulong Rodrigo Duterte si Carlos Yulo matapos ang kanyang tagumpay sa gymnastics.

5. In some cuisines, omelettes are served as a light lunch or dinner with a side salad.

6. The scientist conducted a series of experiments to test her hypothesis.

7. Me gusta salir a caminar por la ciudad y descubrir lugares nuevos, es un pasatiempo muy entretenido.

8. El algodón es un cultivo importante en muchos países africanos.

9. Tila masaya siya, ngunit may lungkot sa kanyang mga mata.

10.

11. Nabangga ang kotse ni Juan bandang alas-tress ng hapon.

12. He plays the guitar in a band.

13. Nagpunta ako sa Hawaii.

14. His speech emphasized the importance of being charitable in thought and action.

15. Hindi ko mapakali ang aking sarili dahil sa aking mga agam-agam tungkol sa aming kasal.

16. Nakakainis ang mga taong nagpaplastikan dahil hindi mo alam kung totoo ba ang sinasabi nila.

17. Lagi na siyang tulala, hindi na siya halos nakakapasok sa paaralan at lagi lang siyang nasa simbaha't nagdarasal.

18. The telephone has also had an impact on entertainment

19. Kaano-ano mo si Juan Dela Cruz?

20. Dumating na sila galing sa Australia.

21. Pabili po ng tiket papuntang Calamba.

22. Dapat magkaroon ng patas na pagtrato sa lahat ng sektor ng lipunan, kabilang ang anak-pawis.

23. Another area of technological advancement that has had a major impact on society is transportation

24. Sa dapit-hapon, masarap magbasa ng libro habang nakatambay sa balcony.

25. Have they finished the renovation of the house?

26. Nagandahan ako sa pagtatapos ng libro.

27. Huwag ka nanag magbibilad.

28. Cutting corners in your exercise routine can lead to injuries or poor results.

29. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

30. Les maladies transmissibles peuvent se propager rapidement et nécessitent une surveillance constante.

31. No puedo imaginar mi vida sin mis amigos, son una parte muy importante de ella.

32. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

33. Motion kan også hjælpe med at reducere risikoen for visse sygdomme, såsom type 2-diabetes, hjertesygdomme og visse former for kræft.

34. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

35. Ang sugal ay maaaring magdulot ng labis na stress, pagkabalisa, at pagkabahala sa mga manlalaro.

36. The moon shines brightly at night.

37. Bumili ako ng pasalubong sa tindahan kahapon.

38. Algunos músicos famosos incluyen a Mozart, Beethoven y Michael Jackson.

39. Ito ho ba ang pinauupahang bahay?

40. Nosotros preparamos una gran cena para celebrar la Nochebuena.

41. Kahit na maliit ang kanyang bahay, basta't nagmamahalan ang mga tao, sapat na iyon.

42. Ang kanyang tula ay punong-puno ng panaghoy at pag-asa.

43. Sadyang mahirap ang pag-aaral ng calculus, ngunit sa tulong ng tamang libro, maari itong maging mas madali.

44. Ang poot ang nagbibigay sa akin ng lakas at determinasyon upang harapin ang mga hamon ng buhay.

45. Naging kaibigan ko muna ang aking nililigawan bago ko siya niligawan upang mas makilala ko siya nang husto.

46. The height of the basket and the court size varies depending on the age and skill level of the players.

47. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

48. ¡Muchas gracias por el regalo!

49. The United States is a representative democracy, where citizens elect representatives to make decisions on their behalf

50. Dahil sa globalisasyon, lubos na umangat ang teknolohiya ng maraming bansa.

Similar Words

beachteacherreachteachfar-reachingteachingsreaching

Recent Searches

whyeachmatindikabuntisannagwalispulubihinagpisalinlabikabiyakretirarlaki-lakihappenedyanhigantepilarecentcocktailniyotangankababayangdi-kawasapositibokumananwednesdaymagbagong-anyoikinabubuhaypatientmuchanagtatanongcreatinglabisnapakahusaynakakagalangingisi-ngisingmang-aawittinaasanpamanhikannagsagawageneratenakabluereaksiyonmakipag-barkadatumahimiknagkwentopaglisansakristaninvesting:minamahalmahahanaytatlumpungsaritamaisippagtangispaghuhugaslumamangdamitprotestanapalitanglumayokondisyonnapatigilactualidadnagwagikayabanganpagkaangatperyahanumulantumutuboambisyosangnakapasoksasamahanpagkatakothitamakikiligomungkahimagasinenforcingpakiramdamlansanganpartspaidpisngitinataluntonmusicaleskakilalahintuturotugimagkikitasakalingjeepneypigilannasunognatitiyaktradisyonbahagyanakarinigcomputersumasaliwrightsawitanislanddesign,nagniningningescuelasbilihinsumasayawkampanaexperience,sinisimukhalittledumilatctricaskauntimaranasansafefranciscomaliitpagkabatamalambotnalugodbinatabinatilyobandadesarrollarmagdaansisipainquarantineamendmentsmaglabapalakacubiclewifimobiletienenkomunidadexpertisepinagkasundomaistorbopangkatartesumasakittalentcoalkasakitadditionally,katagalancarbonpataypasasaandiwatabumabagparanganaysamakatwidlookedchoinaggaladinanasmukapisobecomingdiagnosticpangingimisalasinampalnilulonbalancessufferrumaragasangulamasulkarnekablanwordsnobsanreserveskalanso-calledlateleytesinipangprocesosalamatverykamatispag-aaralkapitbahaytumindigdebateskararatingnagreplyayudapyestaperangtandasumangnutrientes