Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "matigas"

1. "Ang taong nagiging bato sa huli, dapat alisin ang sariling uka" ay isang bukambibig na nagpapahiwatig na ang mga taong nagiging matigas ang loob o nagbubulag-bulagan sa mga sitwasyon ay dapat magbago.

2. Naramdam ng pagkaawa si Mang Kandoy kaya't agad niyang binato ng isang piraso ng matigas na kahoy ang tigre upang malihis ang atensyon nito sa usa.

3. Walang matigas na tinapay sa gutom na tao.

Random Sentences

1. Después de estudiar durante horas, necesito un descanso.

2. Pasensya ka na anak, ang lahat ng ginagawa namin ng iyong ama ay para sa iyo.

3. Mahalagang igalang ang kalayaan ng ibang tao sa pagpapasiya ng kanilang mga sariling buhay.

4. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

5. Medarbejdere kan deltage i mentorprogrammer for at forbedre deres færdigheder.

6. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

7. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

8. Sweetness can be a source of comfort and pleasure for many people.

9. In 2014, LeBron returned to the Cleveland Cavaliers and delivered the franchise's first-ever NBA championship in 2016, leading them to overcome a 3-1 deficit in the Finals against the Golden State Warriors.

10. Sa mga lugar na malapit sa ilog, ang mga punong-kahoy ay nakakatulong sa pagpapabuti ng kalidad ng tubig.

11. Na ikaw ay isang musmos lang na wala pang alam.

12. Ang pagguhit ay isang paraan upang i-express ang mga emosyon at ideya.

13. This is my girl, Jacky. pagpapakilala ni Maico sa akin.

14. Limitations can impact one's career, relationships, and overall quality of life.

15. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

16. She's always creating drama over nothing - it's just a storm in a teacup.

17. Umabot sa hukuman ang panaghoy ng mga biktima ng kalamidad para humingi ng hustisya.

18. Einstein's contributions to science have had significant implications for our understanding of the universe and our place in it.

19. Ignorar nuestra conciencia puede llevar a sentimientos de arrepentimiento y remordimiento.

20. Titira kami sa Banawe sa darating na panahon.

21. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

22. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

23. Ang nagdudumaling laro ng chess ay nangangailangan ng matinding kasanayan sa pagtatanghal ng mga hakbang at galaw.

24. I heard that the restaurant has bad service, but I'll take it with a grain of salt until I try it myself.

25. The stock market can provide opportunities for diversifying investment portfolios.

26. Kapag may tiyaga, may nilaga.

27. Investors can invest in a variety of asset classes, such as stocks, bonds, real estate, and commodities.

28. Overcoming challenges requires dedication, resilience, and a never-give-up attitude.

29. Nakakatuwang malaman na maraming kabataan pa rin ang nakikinig at nakakatuklas ng kagandahan ng mga kanta ng Bukas Palad.

30. Bago matulog, naglalaba ako ng aking uniporme para sa darating na school week.

31. Anong klaseng kuwarto ang gusto niya?

32. Sa pagdaan ng panahon, yumabong ang kultura ng pagbibigay ng regalo tuwing Pasko.

33. Gising ka pa?! parang nabigla nyang sabi.

34. Isinalang ni Pinang ang lugaw ngunit napabayaan dahil sa kalalaro.

35. What goes around, comes around.

36. At blive kvinde handler også om at lære at tage vare på sig selv både fysisk og mentalt.

37. Subalit ang mapayapa at matiwasay na pamumuhay ng mga taga-nayon ay biglang binulabog ng masasamang-loob.

38. Jeg kan ikke stoppe med at tænke på ham. Jeg er virkelig forelsket. (I can't stop thinking about him. I'm really in love.)

39. Anong oras nagbabasa si Katie?

40. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

41. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

42. He has been writing a novel for six months.

43. Las plantas nativas son especies que se encuentran de forma natural en un determinado lugar y son importantes para la conservación de la biodiversidad.

44. They ride their bikes in the park.

45. Facebook Marketplace is a platform where users can buy and sell items locally.

46.

47. Påsken er en tid, hvor mange mennesker giver til velgørende formål og tænker på andre, der har brug for hjælp.

48. Nagtatanong-tanong ako sa kanyang mga kaibigan upang malaman kung ano ang mga gusto at ayaw ng aking nililigawan.

49. Danske møbler er kendt for deres høje kvalitet og eksporteres til mange lande.

50. Sa pagsasagawa ng outreach program, ang bayanihan ng mga organisasyon ay nagdulot ng pag-asa at pag-asa sa mga benepisyaryo.

Recent Searches

masayamatigasakmangmaduras1980natabunansalu-salonagbibigaymakatio-orderbarkoklasengnaghanapobservation,medicinesoremamiboholnagsineoffernetflixrailwayspsssbwahahahahahamaluwangarghmainitdemocracypakibigyannapatayointeresthistoriakomedorwidelynahulaaniskoangkannatalongmini-helicopteragosnagreklamomagpa-ospitallendingnawalangabrilsiniyasattatlumpungnagkasakitpampagandacarlosabernagtutulaknitongmagagamitberetirewardingyonlabinsiyamsumalapalagingnagugutomibinaonatensyongsinundanpumulotnagagamitchefanimutilizarexpertisepangakoalmacenarmalikottumindigpinalayasmakapalsarilimbricoshojasluisworkingwaringpamimilhinganywherecubicleresearch:badingmagtipidbreakchadaffectnumbersumimangotdevelopmentsnathoughtsprogramacomputerepeternagcurveapollolumakipublishedaplicacionesjuanabenesmallobtenerpalavariedadnaglalaronapawiklimanamumulotmanagerespadanagkapilatkaarawanpag-ibigtiningnanhjemstedskabtmisteryomanonoodbinasaflyvemaskinerperpektingkabutihaninimbitainformedkakuwentuhankailannapigilandelasugalnarooninastaeroplanomagkakaanakshopeemaliwanagnadamanakatayodayssyadisyembreboksingmagtiwalamaintaindi-kawasaalamidmasipagkuwartongskyldes,peroyorktumalontondodalhinformasanayipatuloymagandasagotkanangnasasalinanmanunulatcomputere,sinisiraiginitgitkonsultasyonbahagyasabogisusuottamaraweleksyonisipanattractivepalibhasanakatunghaybagyopagdiriwangibangbukagayunmanluneskamalayaninantaykarangalanlongkawili-wilioftepaketedistanciapresleygratificante,pinilitmasyadongairportpinatira