Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "kagandahag"

1. Gayunpaman, ang kapintasang iyon ay hindi nakikita ng mga tao dahil sa kagandahag loob na ipina mamalas ng mag-asawa.

Random Sentences

1. Mahalaga ang papel ng edukasyon sa pagpapalawig ng kaalaman at oportunidad para sa sektor ng anak-pawis.

2. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

3. My friends surprised me with a birthday cake at midnight.

4. Los agricultores merecen ser valorados y respetados por su trabajo duro y su contribución a la sociedad.

5. Gusto kong mamasyal sa Manila zoo.

6. Binigyan niya ng kendi ang bata.

7. The patient's immune system was compromised due to their leukemia, and they were advised to take extra precautions to avoid infections.

8. At have et håb om at blive en bedre person kan motivere os til at vokse og udvikle os.

9. The number you have dialled is either unattended or...

10. She decorated the cake with colorful sprinkles and frosting.

11. Mahal ang mga bilihin sa Japan.

12. Will Smith is a versatile actor and rapper known for his roles in films like "Men in Black" and "The Pursuit of Happyness."

13. Tara Beauty. Mag-gala naman tayo ngayong araw. aniya.

14. La seguridad en línea es importante para proteger la información personal y financiera.

15. Si Aguinaldo ay nahuli ng mga Amerikano noong 1901 sa Palanan, Isabela.

16. L'intelligence artificielle peut être utilisée pour détecter les fraudes financières et les menaces à la sécurité.

17. Hanggang sa dulo ng mundo.

18. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

19. Nous avons prévu une lune de miel en Italie.

20. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

21. Les élèves doivent travailler dur pour obtenir de bonnes notes.

22. Representatives participate in legislative processes, proposing and voting on laws and policies.

23. Los bebés recién nacidos tienen un olor dulce y tierno.

24. Naglaba ang kalalakihan.

25. This can include reading other books on the same topic, interviewing experts, or gathering data

26. Ito ba ang papunta sa simbahan?

27. Hindi kita puwedeng iwan dahil mahal kita.

28. Les travailleurs doivent souvent se soumettre à une évaluation annuelle de leur performance.

29. Ano ang inireseta ng doktor mo sa iyo?

30. Hinayaan ko siyang tulala sa kanyang pag-iisip bago ko siya kausapin.

31. The cuisine in Los Angeles reflects its diverse population, offering a wide range of international and fusion culinary experiences.

32. Hindi niya inaasahan ang biglaang pagbisita ng kanyang kaibigan.

33. The backpack was so hefty, it felt like it weighed a ton.

34. Børn har brug for at lære om kulturelle forskelle og respekt for mangfoldighed.

35. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

36. Ang dami daw buwaya sa kongreso.

37. Ang laki-laki ng cardigan na ito.

38. La motivation est un élément clé de la réussite, car elle permet de maintenir un niveau d'engagement élevé dans l'accomplissement d'un objectif.

39. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

40. Doa juga dapat dijadikan sarana untuk memohon perlindungan dan keberkahan dari Tuhan.

41. Ang pagsasawalang-bahala sa mga mensahe ng katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

42. Ang punong-kahoy ay nagbibigay ng sapat na lilim para sa mga nilalang na nabubuhay sa ilalim nito.

43. Ang pagpapakain ng mais sa tamang oras at pag-alaga sa mga halaman ay magbibigay sa iyo ng masaganang ani

44. The library has a variety of books to choose from, ranging from classics to modern literature.

45. Nagtagumpay siya sa kanyang agaw-buhay na laban sa kanyang sakit.

46. Frustration can lead to impulsive or rash decision-making, which can make the situation worse.

47. Kaya kahit nang dalhin ko siya sa isang karnabal, isa lamang ang ninais niyang sakyan.

48. All these years, I have been grateful for the journey and excited for what the future holds.

49. Like a diamond in the sky.

50. Penting untuk memiliki pola pikir yang fleksibel dan terbuka dalam menghadapi tantangan hidup.

Recent Searches

kagandahaglimasawasisentaorderkahaponhinimas-himasinasikasoinaabutannakasandigmahawaankumikinignapakagagandamatapobrengkahulugannakakatandapioneerbumitawdaramdaminnapakamothampaslupanaguguluhanpagtataasmagkaharapnapapikitnaglokohanjingjingculturasmagagamitumiimikvideosintindihinmakapangyarihangnapalitangvillagekinumutanmakakabaliklalakadnaliwanaganuugod-ugodpagkainisngumiwiitinuturingevolucionadonavigationnakiisainiuwimagamotpaostumigilkommunikererfysik,buwenastactokastilanganumangsiyudadbinentahantagpiangkatolisismosapatosnabuhaylumipadbinuksanrightsmaghapongnakapikitmandirigmangpagkataposmasungitsakyanpagsusulitasukalvaledictorianriegaloveuwakpagmasdantalinoawitaniniirogpadalasniyog1970snabigkasmagisipbanlagligaligcompletamenteninahinukaytmicamalawakbarongberetihadlangheybilanginmataasgigisingnocheamendmentsangkopannikaumagatamadginaganoonrosellerestauranttambayanfarmsaraknightpinagnyananiyabusyalaalahugishinogilocospopularlandebumotokinainestarsinapakkantokablanbotantebilaolegislationailmentsmahahabalarobalitanakikitasiguromagulangscientificjokedalandanfireworksnagbungaseestaple1980sellmagpuntapasanlatercommunicationschadpingganscientistabenetheynitongintopollutionmainitstatusiosnilutomacadamiaofferwealthniyantiyasafestoplightipihitdarkhiminilingpeteritinuringcleancertainrangecreatecomunicarsestyrermagingcasesestablishednicepuntabusilaklingidmestskillskumalmanapaunomahusaydahanmagdaraosmaghilamosnoongmarahil