Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "store"

1. At have håb om at gøre en forskel i verden kan føre til store bedrifter.

2. Bumibili ako ng pagkain sa grocery store.

3. Cryptocurrency wallets are used to store and manage digital assets.

4. Drømme kan være små eller store, men alle er vigtige.

5. Hun er min store forelskelse. (She's my big crush.)

6. Landet er hjemsted for en række store virksomheder, der eksporterer til hele verden

7. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

8. May mga pagkakataon na naisip niyang may kailangan siyang bilhin sa grocery store, pero pagdating niya roon, bigla niyang nalimutan kung ano iyon.

9. Oscilloscopes can capture and store waveforms for further analysis and comparison.

10. Pumunta kami kahapon sa department store.

11. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

12. The beauty store has a variety of skincare products, from cleansers to moisturizers.

13. The clothing store has a variety of styles available, from casual to formal.

14. The grocery store offers a variety of fresh produce, including fruits and vegetables.

15. The pretty lady at the store helped me find the product I was looking for.

16. The store has a variety of sizes available, from small to extra-large.

17. The store offers a store credit for returns instead of a cash refund.

18. The store offers a variety of products to suit different needs and preferences.

19. The store was closed, and therefore we had to come back later.

20. The website's online store has a great selection of products at affordable prices.

Random Sentences

1. He is not watching a movie tonight.

2. Saglit lang lang naging kami. Sabi niya sa akin..

3. Ang kanyang malalim na pangarap ay animo'y imposibleng maabot ngunit patuloy pa rin siyang nagsusumikap.

4. Mataaas na ang araw nang lumabas si Aling Marta sa bakuran ng kanilang maliit na barung-barong.

5. The momentum of the protest grew as more people joined the march.

6. Dogs have a keen sense of smell and are often used in law enforcement and search and rescue operations.

7. Mahusay mag drawing si John.

8. The cuisine in Los Angeles reflects its diverse population, offering a wide range of international and fusion culinary experiences.

9. Jeg er i gang med at skynde mig at få alt færdigt til mødet. (I'm in a hurry to finish everything for the meeting.)

10. Nang makita ang paparating na ulan, kumaripas ng uwi ang mga bata mula sa palaruan.

11. Narito ang pagkain mo.

12. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

13. Itinaas niya ang tirante ng kamiseta.

14. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

15. Al que madruga, Dios lo ayuda.

16. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

17. Ang pagiging malilimutin ni Leah ay dala ng labis na pagkaabala sa trabaho.

18. The guilty verdict was handed down to the culprit in the embezzlement trial.

19. H-hindi na sabi eh! inis na sabi nya.

20. Nais niyang mag-iwan ng sulat para sa kanyang mahal.

21. Limitations can be a result of fear or lack of confidence.

22. Mathematical proofs are used to verify the validity of mathematical statements.

23. En Argentina, el Día de San Valentín se celebra en el mes de julio.

24. Sweetness can be addictive and overconsumption can lead to health issues, such as obesity and diabetes.

25. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

26. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

27. Tinaas ko yung isang kilay ko, I'm working for him noh.

28. Kulay itim ang libro ng kaklase ko.

29. The police were trying to determine the culprit behind the burglary.

30. Has he learned how to play the guitar?

31. The Great Wall of China is an impressive wonder of engineering and history.

32. Ang laki ng gagamba.

33. Madalas mapagalitan si Jake dahil sa pagiging malilimutin niya sa trabaho.

34. Les comportements à risque tels que la consommation

35. Kawah Ijen di Jawa Timur adalah tempat wisata populer untuk melihat api biru yang terlihat di dalam kawah gunung berapi.

36. Ang pag-ulan sa labas ay animo'y nagpapaligaya sa mga halaman sa hardin.

37. Ada udang di balik batu.

38.

39. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

40. Nagtayo kami ng kandila sa mesa at aksidente naming nasindihan ang table cloth.

41. Maraming Salamat!

42. Matapos mabasag ang aking paboritong gamit, hindi ko napigilang maglabas ng malalim na himutok.

43. The clothing store has a variety of styles available, from casual to formal.

44. Women's relationships with their bodies have been shaped by societal expectations and cultural norms.

45. Napatunayan nilang lason ang mga bunga nang isang araw ay may napadpad na manlalakbay sa kanilang bayan.

46. Børns leg og kreativitet er en vigtig del af deres udvikling.

47. Buhay ay di ganyan.

48. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

49. Third parties, such as the Libertarian Party and the Green Party, also exist but have limited influence

50. Das Gewissen kann uns helfen, die Auswirkungen unserer Handlungen auf die Welt um uns herum zu verstehen.

Recent Searches

storecharmingpaaaltpetsaprosperexamplecreatemapefficientinteligentescallingbetaedit:doinghatedigitalprotestaaggressionuniquegenerabamaanghangnagtagisanmasayapaaralannakumbinsipusamagturosumayawmasaktankahaponasawahulyoampliamakalabasprogramahahahahuertoredigeringskabeochandobillbabelimitanidatifuncionarsumamatinawagflyvemaskinerwednesdaykonsiyertomarurusingbilibidpaglakimatikmanrememberalikabukinpagbatitransmitspaidunacultivationshoppingkinahuhumalingan1940halamanboladelegirlnaka-smirkpagtatapospalabuy-laboynamumulottinangkapinakamahabanangangaralmusicianmagkakailanakapagsabikumbinsihinnakitapakikipagtagponakikilalangnaglalakadpare-parehobangladeshkumitabaku-bakongmagkahawakmaalwanglawayinabutannagpalutokakatapospioneernahintakutannapakahabakumakantautak-biyazamboangapinagbigyane-bookshawakkainitannasilawsangabalikatcaracterizanai-dialtatanggapinkanyakatolisismopagbebentakutsilyohumpayperseverance,turonannikaopportunitymisteryoprobinsyamamarilhatinggabiengkantadabinabaratendviderenagwikangemocionalninyonghanapinniyonsuriinumupopanunuksoparaangiwanangobernadoraksidentekulangpublishing,sigloinangdumilimlaruanmasarapkaramdamannoongkasalananjobbathalaelijepogitarcilavelstandlikessawafamebangkopaksaltoparinbiliblandokayblusangsigepulubieducativasletteruboskypekasingtigas1920salaalasinumangritwalspeechesbilhinnumerosasmaestrocentereliteestablishsalarinnasabingsparesyatradisyonnathanpasanabenekaringbiroalambinigyangunderholderdyanjacestar