Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "store"

1. At have håb om at gøre en forskel i verden kan føre til store bedrifter.

2. Bumibili ako ng pagkain sa grocery store.

3. Cryptocurrency wallets are used to store and manage digital assets.

4. Drømme kan være små eller store, men alle er vigtige.

5. Hun er min store forelskelse. (She's my big crush.)

6. Landet er hjemsted for en række store virksomheder, der eksporterer til hele verden

7. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

8. May mga pagkakataon na naisip niyang may kailangan siyang bilhin sa grocery store, pero pagdating niya roon, bigla niyang nalimutan kung ano iyon.

9. Oscilloscopes can capture and store waveforms for further analysis and comparison.

10. Pumunta kami kahapon sa department store.

11. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

12. The beauty store has a variety of skincare products, from cleansers to moisturizers.

13. The clothing store has a variety of styles available, from casual to formal.

14. The grocery store offers a variety of fresh produce, including fruits and vegetables.

15. The pretty lady at the store helped me find the product I was looking for.

16. The store has a variety of sizes available, from small to extra-large.

17. The store offers a store credit for returns instead of a cash refund.

18. The store offers a variety of products to suit different needs and preferences.

19. The store was closed, and therefore we had to come back later.

20. The website's online store has a great selection of products at affordable prices.

Random Sentences

1. Tara na nga Hon! Mga baliw ata yan eh!

2. Isang makisig na binata na halos kaedad din ng magandang prinsesa.

3. Ngunit kahit ganyan ang kinalalagyan.

4. Las plantas de interior son populares para decorar espacios dentro de las casas u oficinas.

5. Hindi siya makabangon at makagawa ng gawaing bahay.

6. Cosecha el maíz cuando las espigas estén completamente maduras

7. Hinanap nito si Bereti noon din.

8. Nakatingin siya sa labas ng bintana, waring may hinihintay.

9. Ang daming linta sa bundok na kanilang inakyat.

10. Umalis sa sakayan ang mga pasahero nang limahan.

11. Ano ho ang nararamdaman niyo?

12. Tengo escalofríos. (I have chills.)

13. Masyadong advanced ang teknolohiya ng bansang Japan kung ikukumpara sa ibang bansa.

14. Umiling siya at umakbay sa akin.

15. Ang mapa ng mundo ay nagpapakita ng lahat ng mga bansa sa buong mundo.

16. Tendremos que tener paciencia hasta que llegue nuestro turno.

17. Al elegir un powerbank, es importante considerar la capacidad de la batería, el tamaño y la compatibilidad con los dispositivos que se cargarán.

18. Ang talambuhay ni Emilio Jacinto ay nagpapakita ng kanyang kabataan at ang kanyang kontribusyon sa rebolusyon.

19. Panahon na lang ang hahatol kung nararapat na ngang ibalik sa dating anyo si Kiko.

20. Ang sugal ay isang bisyong maaaring magdulot ng malaking pinsala sa buhay ng isang tao.

21. Nakakatulong ang malawak na bintana sa silid-aralan upang pumasok ang natural na liwanag sa loob ng silid.

22. Tinuro ng coach kung paano kontrolin ang bola habang tumatakbo.

23. Ang mga batas tungkol sa paggamit ng droga ay mahalaga upang maiwasan ang mga krimen na may kinalaman sa droga.

24. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

25. Humarap sya sakin, What d'you mean locked?!!

26. The musician released a series of singles, leading up to the release of her album.

27. A latte is a popular espresso-based drink that is made with steamed milk.

28. Ang doktor ay pinagpalaluan ng kanyang mga pasyente dahil sa kanyang husay sa pagpapagaling.

29. Hindi pa ako naliligo.

30. Ang huni ng mga Kuliglig at kokak ng mga Palaka ay sumasaliw sa awit ng mga Maya.

31. Many people exchange gifts and cards with friends and family during Christmas as a way of showing love and appreciation.

32. Los agricultores a menudo enfrentan desafíos como sequías, inundaciones y plagas.

33. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

34. Ang nagliliyab na araw ay nagdulot ng matinding init sa buong bayan.

35. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

36. Cuando las plantas tienen al menos dos hojas, trasplántalas al lugar definitivo

37. The Lakers' success can be attributed to their strong team culture, skilled players, and effective coaching.

38. Ang kanyang mga mata ay nagliliyab sa galit matapos marinig ang balita.

39. Tumingin siya sa akin, waring may nais siyang ipahiwatig.

40. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

41. Kailangan nating magfocus sa mga bagay na may kabuluhan at hindi sa kababawang mga bagay sa buhay.

42. Nakatayo ito sa harap ng isang bilao ng kangkong at sa malas niya ay tumatawad.

43. Maraming tao sa tabing-dagat sa tag-araw.

44. A penny saved is a penny earned.

45. Have you studied for the exam?

46. Si Anna ay maganda.

47. Claro, haré todo lo posible por resolver el problema.

48. Pinapakain ng pulotgata ang mga langgam sa aming bakuran.

49. Bumoto ka nang ayon sa idinidikta ng iyong puso.

50. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

Recent Searches

expertyoungstorepalagingagosemailnag-iyakanfansngpuntaasinprovidebinabalikmuchosvideopagbahingbaojackzgrangabejokezoomschoolsbilinbrindarlutosellisugaspeeches1876staplefeedback,detdadherramientanaghilamosngitibawianmapagkatiwalaankasawiang-paladnagtutulungannagtanghalianformappuponnamungarolledmobilepeterbeingthoughtsinfluentialheitopic,ageakinsurroundingsulingtutorialsmessagerefsettingquicklyandyinterviewingtabaexplainimpactedpuntarenacentistalearntechnologiesmitigatepaki-drawingmaintindihananak-mahiraptig-bebentepagkapanalobentangmakapag-uwisagutinbutihalipkongresogulayhinding-hindililymakikitadecreasedhalamankatiedulamahinamaipagmamalakingtmicatradisyonmagta-taxipalaylamangpistanakikilalangatensyongnaligawgandahannagwo-workkumakantanakaakyatnamilipitwakasturondiseasespasensyakaawa-awangestablishelectshiftmemoryginhawaumanopangilkulisapt-ibangnasagutanvelstandmaghahabitumawagneasimulaalas-dospumapaligidmaghatinggabiobservererfotosbairdlaki-lakinangagsipagkantahanpunongkahoypinagsikapanagricultoresmagbabakasyonagwadorpaghalakhaknagmakaawapinagalitannanghihinanagre-reviewnakapaligidnagmamaktolsalu-salomagkakaanakikinasasabikmag-isapagkasabibabasahinpalancamatapobrengpanghihiyangfollowing,pagpilipakikipagbabagtumiravillagenakabibingingnaglokohanbutikimagsisimulamahuhulinagwagitumatanglawactualidadnapapahintoporkangitansiyudadsementongfulfillmentmarangalmasaktanperyahankisapmataumangatmaglabakundigownkasidyosaexperience,kilaykindergartengatolpaglayasnakapikiteducationpa-dayagonalsantosnilolokoproducts:anainventionangelasumpain