Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "store"

1. At have håb om at gøre en forskel i verden kan føre til store bedrifter.

2. Bumibili ako ng pagkain sa grocery store.

3. Cryptocurrency wallets are used to store and manage digital assets.

4. Drømme kan være små eller store, men alle er vigtige.

5. Hun er min store forelskelse. (She's my big crush.)

6. Landet er hjemsted for en række store virksomheder, der eksporterer til hele verden

7. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

8. May mga pagkakataon na naisip niyang may kailangan siyang bilhin sa grocery store, pero pagdating niya roon, bigla niyang nalimutan kung ano iyon.

9. Oscilloscopes can capture and store waveforms for further analysis and comparison.

10. Pumunta kami kahapon sa department store.

11. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

12. The beauty store has a variety of skincare products, from cleansers to moisturizers.

13. The clothing store has a variety of styles available, from casual to formal.

14. The grocery store offers a variety of fresh produce, including fruits and vegetables.

15. The pretty lady at the store helped me find the product I was looking for.

16. The store has a variety of sizes available, from small to extra-large.

17. The store offers a store credit for returns instead of a cash refund.

18. The store offers a variety of products to suit different needs and preferences.

19. The store was closed, and therefore we had to come back later.

20. The website's online store has a great selection of products at affordable prices.

Random Sentences

1. Binili ko ang sapatos dahil sa kanyang magandang disenyo, bagkus ito ay hindi gaanong komportable isuot.

2. En verano, nos encanta hacer barbacoas en el patio durante las vacaciones.

3. Eh? Kelan yun? wala akong maalala, memory gap.

4. Bawal magpakalat ng mga pornograpikong materyal dahil ito ay labag sa batas.

5. Nagulat ako nang biglaan siyang tumawag at nangumusta sa akin.

6. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

7. Different? Ako? Hindi po ako martian.

8. Tumayo na sya, Ok! I'll be going now, see you tomorrow!

9. The acquired assets will be a valuable addition to the company's portfolio.

10. Masyadong maluwang ang pantalon na ito.

11. Pinasalamatan nya ang kanyang mga naging guro.

12. Susunduin ni Nena si Maria sa school.

13. Me encanta pasar tiempo al aire libre durante las vacaciones de primavera.

14. Les étudiants sont encouragés à poursuivre des activités de bénévolat pour développer leurs compétences en leadership.

15. Ipaghanda mo si Lina ng Maghanda ka ng damit

16. Ang dentista ay propesyonal na nag-aalaga sa kalusugan ng ngipin at bibig.

17. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

18. Ang sinabi ng Dakilang Lumikha ay natupad.

19. Medical technology has also advanced in the areas of surgery and therapeutics, such as in robotic surgery and gene therapy

20. Det har også skabt nye muligheder for erhvervslivet og ændret måden, vi arbejder og producerer ting

21. Nagising si Rabona at takot na takot na niyakap ang kaniyang mga magulang.

22. Sa bawat bagong taon, may ritwal silang ginagawa upang magdala ng suwerte at kasaganaan sa buong pamilya.

23. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

24. Isang bata ang lumapit sa magandang babae at nagbigay ng kapiranggot na makakain.

25. El discurso del líder produjo un gran entusiasmo entre sus seguidores.

26. Nasa Ilocos si Tess sa Disyembre.

27. Naging masyadong mayabang ang bata at nararapat daw itong parusahan.

28. Hindi na napigilan ni Anna ang kanyang hinagpis nang marinig ang masamang balita.

29. Hindi ibig sabihin na kuripot ang isang tao ay madamot na ito.

30. He is not running in the park.

31. Ang mahal pala ng ticket papuntang Amerika!

32. Limitations can be physical disabilities, such as hearing or vision loss, or mental health conditions, such as anxiety or depression.

33. Mga nuno, patawarin po ninyo ang aking anak.

34. Yumabong ang pagkakaisa ng mga tao sa panahon ng krisis.

35. Ang paglabas ng impormasyon tungkol sa isang malaking skandalo ay binulabog ang buong bansa.

36. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

37. Andre helte er stille helte, der arbejder i skyggerne.

38. My son drew a picture of a pretty lady with a big smile.

39. Musk's innovations have transformed industries such as aerospace, automotive, and transportation.

40. Las vacaciones son un momento para crear recuerdos inolvidables con seres queridos.

41. Einstein developed the theory of special relativity while working as a patent clerk in Bern, Switzerland.

42. The number you have dialled is either unattended or...

43. "A dog's love is unconditional."

44. Alles hat ein Ende, nur die Wurst hat zwei.

45. I am teaching English to my students.

46. Madalas na may agam-agam sa buhay ng mga estudyante tuwing magkakaroon ng exam o project submission.

47. Ang mga pangarap ay nagbibigay sa atin ng direksyon upang magkaroon ng layunin sa buhay.

48. Pinakain ni Rose si Mrs. Marchant ng almusal.

49. Oy bawal PDA dito! natatawang sabi ni Lana.

50. Pahiram ng iyong earphones, gusto ko lang makinig ng musika.

Recent Searches

storeenforcingcutinyostudiedpinilinghapasinseenconsiderpinagsulatbitbitcreatingevolvedgitaraeffectagadkalayaanpresleynagawahudyatmaluwangagilitynapakabagalmedyolumuwastradeafteralbularyonahawakanchangedagat-dagatanhalagangunitganitoaminidaraantumalimdiwatangmungkahipagkatdaliwayspagsagotdiplomadoonpatientinventedniyocapitalistitsuraakomamulotbringnapalakasluhamustwaitlaamangstartpshevenkahariansiniyasatdreamsdadathinggagandainutusanmatalopahabolkalawangingtwoaroundkabighatransportmini-helicopterjosephlupaarawtypesuselawanakararaanhongmanamis-namistwo-partypaananpopularmailappigingknowbilisvelfungerendeyoutubedespuesmeetingnoblekamakontraquicklyteamlandokurbatanazarenonapanoodculturespaglakipamamalakadsundoinglaylaytools,ipapaputolpagtatanimfundrisemagkasamangnumerosasencuestascasaumuponagpapanggapmasasalubongnilimaspusangpinggaoffercontinuesattorneyleukemiaboyadvancesklasengdeclaresiyalibertarianweddingdumikitkumainmongchambersbasketbolwatchinginagawskabtsiyentoslockdowntonmanunulatpagiisipmahalagasukattunayfuryhighestorasbalediktoryannakilalagalakreserbasyonnatinkamaliangardenbakenagtutulunganpinapanoodbisitanatingbirthdaytomorrowresponsibleleaditinatapatpasanhinipan-hipanpilingmanygasolinakatawanngipinsumaliwlawsdejasiguradokainismesangnagsisunodtelangelectionspinabayaanguidanceanak-pawisginoongumanoabstainingbroadcastipinagbilingasawasumabogoffentligmatandang-matanda