Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "store"

1. At have håb om at gøre en forskel i verden kan føre til store bedrifter.

2. Bumibili ako ng pagkain sa grocery store.

3. Cryptocurrency wallets are used to store and manage digital assets.

4. Drømme kan være små eller store, men alle er vigtige.

5. Hun er min store forelskelse. (She's my big crush.)

6. Landet er hjemsted for en række store virksomheder, der eksporterer til hele verden

7. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

8. May mga pagkakataon na naisip niyang may kailangan siyang bilhin sa grocery store, pero pagdating niya roon, bigla niyang nalimutan kung ano iyon.

9. Oscilloscopes can capture and store waveforms for further analysis and comparison.

10. Pumunta kami kahapon sa department store.

11. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

12. The beauty store has a variety of skincare products, from cleansers to moisturizers.

13. The clothing store has a variety of styles available, from casual to formal.

14. The grocery store offers a variety of fresh produce, including fruits and vegetables.

15. The pretty lady at the store helped me find the product I was looking for.

16. The store has a variety of sizes available, from small to extra-large.

17. The store offers a store credit for returns instead of a cash refund.

18. The store offers a variety of products to suit different needs and preferences.

19. The store was closed, and therefore we had to come back later.

20. The website's online store has a great selection of products at affordable prices.

Random Sentences

1. Guilty. simpleng sabi niya saka ngumiti ng malapad.

2. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

3. The pursuit of money can have both positive and negative effects on people's lives and relationships.

4. Kumaliwa ka sa susunod na kanto.

5. Nahihilo ako dahil masyadong mainit ngayon.

6. Nabigla siya nang biglang may kumatok sa pinto.

7. Baka puwedeng hiramin mo ang iyong sasakyan para sa isang biyahe.

8. Ano ho ang gusto ninyong bilhin?

9. Foreclosed properties are often sold at a discounted price, making them an attractive option for real estate investors.

10. Muchas personas pobres no tienen acceso a servicios básicos como la educación y la atención médica.

11. El proyecto produjo resultados exitosos gracias al esfuerzo del equipo.

12. Work can also provide opportunities for personal and professional growth.

13. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

14. The United States is a representative democracy, where citizens elect representatives to make decisions on their behalf

15. Hindi kaya... kinumutan nya ako? Ah, malabo malabo.

16. Maaliwalas ang simoy ng hangin sa probinsya.

17. Sa pag-aaral ng mga palaisipan, mahalagang maging mapanuri at malikhain upang malutas ang suliranin.

18. Sa paggamit ng mga kagamitan, huwag magpabaya sa tamang pag-aalaga at pagpapanatili nito.

19. Hindi ko alam kung may pag-asa ako sa iyo, pero sana pwede ba kitang mahalin?

20. Kakain ako sa kapeterya mamayang tanghali.

21. El perro de mi amigo es muy juguetón y siempre me hace reír.

22. Ang tubig-ulan ay nakakatulong sa pagpapanatili ng balanse ng mga ekosistema.

23. Sa aming barangay, nagkaroon ng malawakang paglilinis ng kanal dahil sa bayanihan ng mga residente.

24. At habang itinatapat nito ang balde sa gripo, muli niyang nakita na nginingisihan siya nito.

25. It may dull our imagination and intelligence.

26. Di natagalan, isinawak niya ang kamay sa nalalabing tubig sa balde.

27. Ang mahal naman ng laptop na binili ni Andy.

28. Mabuti pa roon, kahit nakabilad sa init.

29. Asegúrate de que el área esté libre de maleza y que el suelo sea bien drenado

30. The team's colors are purple and gold, and they play their home games at the Staples Center.

31. Ha? Anong konek ng gas sa taong nagugutom?

32. Huwag daw niyang papansinin si Ogor.

33. May mga taong naniniwala na ang digmaan ay hindi ang solusyon sa mga suliranin ng mundo.

34. Sa muling pagtuturo ng relihiyon, natutunan ng mga bata ang konsepto ng purgatoryo.

35. Sa isang malayong pook sa Pilipinas nakatira ang mag-asawang sina Mang Kandoy at Aling Pising.

36. Hindi mo sadyang nakuha ang isang mataas na marka sa pagsusulit.

37. The momentum of the wave carried the surfer towards the shore.

38. La música es una parte importante de la

39. She spilled the beans about the surprise party and ruined the whole thing.

40. Gaano katagal niyang hinintay ang pakete?

41. Matagal ko na syang kaibigan sa Facebook.

42. Nationalism can also lead to authoritarianism and repression of dissent.

43. Siya ang aking kaulayaw sa lahat ng bagay.

44. Hindi maganda ang pagmamalabis sa trabaho dahil maaaring magdulot ito ng pagkaburnout.

45. A lot of traffic on the highway delayed our trip.

46. The momentum of the car increased as it went downhill.

47. The stockbroker warned his client about investing in risky assets.

48. The player who has the ball is called the "offensive player," and the player guarding him is called the "defensive player."

49. Ibinigay ko ang aking buong atensyon sa kanyang mga salita upang maunawaan ang kanyang mga kahilingan.

50. Fathers can be strong role models, providing guidance and support to their children.

Recent Searches

sincestoreclassroomataquesmasasabiulosupilinsnaviewstrainingmobilepasyadivideshighagastandartificialcesbokmapapacallpreviouslypersonsgenerateauthorobstacleshangaringideyacommunicateamingevilirogformtiyareadingechaveformaipapahingaclientessteerfredmind:seenanimomaliksiblusainaloktechnologicalalignssambitcreatingrepresentedimprovedinternalbasacontentpersistent,statingcommercestreamingcasesrelevantkitsusunodshifteffectmapadaliandroidformsjoedependinglivestructureentryharmfulbinilingbackmulingpupuntasystemadaptabilityconditionheftydinpautanghinalungkatpagsasalitaclockshockrequiregitaragapcompletetabathingmitigateclientesafeguiltymerejuniouminomsecarseipinaputingoverviewkumukuhaitinaasbaku-bakongnagpapaniwalanagtutulunganmagsalitakakuwentuhanpunung-punopagkalungkotpunong-punonapakahangaculturapinagmamalakipagluluksanaminmakaratingsapatosnakangisinghaponmagkaibigannagmakaawaconsistbaranggaypinakamatabangnakatunghaykaaya-ayangmagpa-checkupfansnaiinismagbabakasyonnagbanggaanmedya-agwapunongkahoymagkahawakrabealbularyotatawagnakapagsabisikre,papagalitanmangangahoynagpaiyakpamanhikannagandahannamulatnakakabangontumawagnagtutulakkabutihanmakatinakatirapanghihiyangnagpabayadtinangkanagsagawadisenyongnasasabihannasamagsusunurannagkasunogkatawangnakakagalanahawakannagsasagotnanlilisiknagsunuranmakikikainflyvemaskinerpagmamanehonahihiyanguusapanparehongdadalawinbefolkningen,nabubuhayalas-diyesnawalangnamumulotnakuhangmakapagsabihinilaaraw-kumidlatnabighaninanlalamigpagtutoldiscipliner,teknologipagsisisirebolusyonnegro-slavesnagmistulangemocionantesasamahan