Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "store"

1. At have håb om at gøre en forskel i verden kan føre til store bedrifter.

2. Bumibili ako ng pagkain sa grocery store.

3. Cryptocurrency wallets are used to store and manage digital assets.

4. Drømme kan være små eller store, men alle er vigtige.

5. Hun er min store forelskelse. (She's my big crush.)

6. Landet er hjemsted for en række store virksomheder, der eksporterer til hele verden

7. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

8. May mga pagkakataon na naisip niyang may kailangan siyang bilhin sa grocery store, pero pagdating niya roon, bigla niyang nalimutan kung ano iyon.

9. Oscilloscopes can capture and store waveforms for further analysis and comparison.

10. Pumunta kami kahapon sa department store.

11. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

12. The beauty store has a variety of skincare products, from cleansers to moisturizers.

13. The clothing store has a variety of styles available, from casual to formal.

14. The grocery store offers a variety of fresh produce, including fruits and vegetables.

15. The pretty lady at the store helped me find the product I was looking for.

16. The store has a variety of sizes available, from small to extra-large.

17. The store offers a store credit for returns instead of a cash refund.

18. The store offers a variety of products to suit different needs and preferences.

19. The store was closed, and therefore we had to come back later.

20. The website's online store has a great selection of products at affordable prices.

Random Sentences

1. Alam kong parang biglaan, pero sana pwede ba kita makilala?

2. Russell Westbrook is known for his explosive athleticism and ability to record triple-doubles.

3. Malayo ho ba ang estasyon ng tren?

4. Nagpunta ako sa may lobby para magisip.

5. Medyo napalakas ang pag kakauntog nya sa pader.

6. Kailan niyo naman balak magpakasal?

7. Para darle sabor a un guiso, puedes añadir una ramita de hierbas de tu elección.

8. Sa anong materyales gawa ang bag?

9. La agricultura sostenible es una práctica importante para preservar la tierra y el medio ambiente.

10. They were originally established in 1947 as the Minneapolis Lakers before relocating to Los Angeles in 1960.

11. Kapitbahay ni Armael si Juang malilimutin.

12. Humarap sya sakin, What d'you mean locked?!!

13. Si Maria ay mahusay sa math, datapwat hindi siya mahilig sa science.

14. Está claro que necesitamos más tiempo para completar el proyecto.

15. Sa kasal, karaniwang nagmula ang mga panalangin upang hilingin ang magandang buhay para sa mag-asawa.

16. Ofte bliver helte hyldet efter deres død.

17. Tila may pagdududa siya sa katapatan ng kanyang kaibigan.

18.

19. Nagpasensiya na lang si Aling Rosa, napagsilbihan naman siya kahit paano ng anak.

20. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

21. Kenji nandito na siya! sabi sa akin ni Grace.

22. Sa condo ko. nakangiti niya pang sagot.

23. Kapag dapit-hapon, masarap magpahinga sa parang habang nakatingin sa mga bituin.

24. Gawin mo ang nararapat.

25. Ito na yata ang pinakamatabang babae na nakilala niya.

26. Nangagsibili kami ng mga damit.

27. Der er en række organisationer og programmer, der tilbyder hjælp til mennesker, der kæmper med gamblingafhængighed.

28. Women have faced discrimination and barriers in many areas of life, including education and employment.

29. Jeg tror, jeg er ved at blive forelsket i ham. (I think I'm starting to fall in love with him.)

30. Masarap at manamis-namis ang prutas.

31. Pinag-iingat ng mga awtoridad ang mga mamamayan laban sa mga salarin na gumagala sa paligid.

32. Tinangka niya itong pigilan ngunit huli na ng naabutan niya ang matanda.

33. Baby fever can affect people of various ages, backgrounds, and genders.

34. Ang tagumpay ng aking mga estudyante ay siyang ikinagagalak ng aking puso.

35. Nakakamiss kumain ng pulotgata tuwing tag-araw kasama ng pamilya.

36. Halos wala na itong makain dahil sa lockdown.

37. Bilang ganting langit sa mga kabutihan nina Waldo at Busyang, sila ay pinagkalooban ng isang anak na pagkaganda-ganda.

38. When the blazing sun is gone

39. Anong panghimagas ang gusto nila?

40. Di rin ako paulit-ulit ha! Di yan ang lagi kong sagot!

41. Itinapon nito agad ang nasabing bunga pagkatikim dahil sa sobrang asim.

42. Sa kasal, ang mga dalagang kasama ng bride ay nagdadala ng mga bulaklak at kumakanta.

43. Bis später! - See you later!

44. Despite his success, Presley's personal life was plagued by controversy

45. Itinuring nila itong kapamilya at nakatulong pa kay Roque sa pang-araw-araw na pahahanap ng pagkain.

46. He is not watching a movie tonight.

47. I was going to surprise her, but I accidentally spilled the beans.

48. Einstein's most famous equation, E=mc², describes the relationship between energy and mass.

49. Leukemia can be acute or chronic, depending on how quickly the disease progresses.

50. Rebuilding trust and repairing a relationship after cheating can be a difficult and lengthy process that requires communication, commitment, and forgiveness from both partners.

Recent Searches

storebirokumpunihinstreamingbitawaninilalabaselecttransmitspangalanhealthemphasismalamigsumunodbedsnagpepekeinaantaymerchandisemakapasakinikilalangnaghanapginaganapalagainjurynangyarinanlakiseniordiscoverednag-iisipmakipagtalonaglinislalawiganmagdilimabuhingspreadmaghahatidpakitimplamakelibrotarcilakampeonmalezasponsorships,pinagtagpocleanculturalnagpakunotnakapapasongmagbibiyaheangelicapagngitit-shirtnakabluemahuhulikalabansimbahantumatawadpwestosamantalangtinulak-tulakstockspalasyoattorneyxviinamuhayvidenskabenintensidadnilapitannahulogcoughingbinibilangelenamataasminu-minutonakangitinggrowthanongganangginawaranaksidenteinvitationisamahistorianagbibiroasongtutubuinschoolsstruggledbinasaharingninongtumutubobulaklakritodalawaarbejderhugis-uloturismodahancelularessumakaykilalasueloresultnaibibigayhumanosadamalinislabanpublishedkartonitemsengkantadaislageneratelightsmalapitclassmateoffentligcableiyonevolvesupportbackfacultykamisetamagbantaysmokingstuffedyakaptuwidnakiisamedicaltrueprintvitaminmahulogvidenskabenterdistanciabagongsumungawcapitalistburdenmakahiramlabinsiyamnyananyryaniphonesagingprinsipemaisipsecarsenaggingnasiyahancreatingradyogupitexitsakupinprogramming,inhaleditokinahuhumalinganmatamisnanlilimahidmagpa-ospitalmagkakaanaklandaslorenaginooaftermaasahannakahigangnapatayoriyanpaanongnangahasaktibistakalikasanhumiwalayinaabotnaaksidentenakapagproposelahatpakinabanganapatnapumakaraannagkasakitpamumuhaytitanaawaoktubrebinuksanmapagbigaysteamshipsipinansasahogcover,tarangkahan,kaalaman