Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "news"

1. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

2. Bawal magpapakalat ng mga fake news dahil ito ay nagdudulot ng kaguluhan at kawalan ng tiwala sa media.

3. Before the advent of television, people had to rely on radio, newspapers, and magazines for their news and entertainment

4. He maintained a contentious relationship with the media, frequently referring to some outlets as "fake news."

5. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

6. I fell for an April Fool's joke on social media this year - a friend posted a fake news article that was so convincing I thought it was real.

7. Laganap ang fake news sa internet.

8. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

9. Receiving good news can create a sense of euphoria that can last for hours.

10. Sa ganang iyo, dapat bang palakasin pa ang kampanya laban sa fake news?

11. The "News Feed" on Facebook displays a personalized stream of updates from friends, pages, and groups that a user follows.

12. The news might be biased, so take it with a grain of salt and do your own research.

13. The stock market can be influenced by global events and news that impact multiple sectors and industries.

14. The traffic on social media posts spiked after the news went viral.

15. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

16. Twitter is known for its role in breaking news and providing a platform for public discussions and debates.

Random Sentences

1. Ayaw mo ba akong kasabay? maya-maya eh tanong ni Anthony.

2. Napuyat ako kakapanood ng netflix.

3. Analog oscilloscopes use cathode ray tubes (CRTs) to display waveforms.

4. Parating na rin yun. Bayaan mo siya may susi naman yun eh.

5. El cuaderno de Leonardo da Vinci contiene muchos dibujos y anotaciones sobre sus inventos.

6. Smoking can also increase the risk of other health issues such as stroke, emphysema, and gum disease.

7. Disente tignan ang kulay puti.

8. Anong nakakatawa? sabay naming tinanong ni Sara

9. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

10. Ano ang pangalan ng babaeng buntis?

11. La salsa de chile es una de mis favoritas, me gusta el sabor picante.

12. Scissors with serrated blades are useful for cutting through tough materials like cardboard or thick fabrics.

13. Bawal mag-ingay sa loob ng liblib na lugar dahil ito ay nakakabulahaw sa mga hayop.

14. I spotted a beautiful lady at the art gallery, and had to paint a portrait of her.

15. Binigyan niya ako ng aklat tungkol sa kasaysayan ng panitikan ng Asya.

16. Nakakalasing pala ang wine pag napasobra.

17. The decision to release the product early was a risky but ultimately successful strategy.

18. Claro que entiendo tu punto de vista.

19. Dette skyldes, at den offentlige regulering sikrer, at der er en vis grad af social retfærdighed i økonomien, mens den frie markedsøkonomi sikrer, at der er incitamenter til at skabe vækst og innovation

20. Omelettes are a popular choice for those following a low-carb or high-protein diet.

21. Quiero ser escritor y publicar un libro algún día. (I want to be a writer and publish a book someday.)

22. The movie was rated R, and therefore she wasn't allowed to watch it.

23. Maari mo ba akong iguhit?

24. Después de la tormenta, el cielo se vuelve más oscuro y las nubes se alejan.

25. Eine klare Gewissensentscheidung kann uns helfen, Verantwortung für unsere Handlungen zu übernehmen.

26. We were trying to keep the details of our business plan under wraps, but one of our investors let the cat out of the bag to our competitors.

27. Up above the world so high

28. Ang laman ay malasutla at matamis.

29. Bumili si Ana ng lapis sa tindahan.

30. In some cuisines, omelettes are served as a light lunch or dinner with a side salad.

31. El tiempo todo lo cura.

32. Napapasabay din sa pagimbay ang mahagway na Kawayan kasama ang Pagong na nagbababa at nagtataas ng bahay-bahayan.

33. Rektanggulo ang hugis ng mesa namin.

34. Ang tubig-ulan ay maaaring magdulot ng kaguluhan sa mga lugar na hindi handa sa mga pagbabago sa panahon.

35. Hey! Wag mo ngang pakealaman yan! sigaw ko sa kanya.

36. We need to optimize our website for mobile devices to improve user experience.

37. The culprit behind the hit-and-run accident was later caught and charged with vehicular manslaughter.

38. Good morning. tapos nag smile ako

39. Bilang paglilinaw, ang parangal ay ibibigay sa buong grupo, hindi lamang sa isang tao.

40. Palagi sya nagbibigay ng pagkain sa pulubi.

41. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

42. Athletes who achieve remarkable feats often credit their success to their unwavering dedication and training regimen.

43. Ang mensahe ay ibinigay ng isang misteryosong lalake.

44. The website's user interface is very user-friendly and easy to navigate.

45. Iyong kulay itim na bag ang bag ko.

46. Mabini Hall ang tawag sa gusali kung saan nagsisimula ang mga klase sa Polytechnic University of the Philippines.

47. Banyak orang Indonesia yang mengajarkan doa sejak usia dini, sebagai salah satu nilai-nilai agama dan moral.

48. Ano ang palitan ng dolyar sa peso?

49. Twitter is also used by businesses and brands for marketing, customer engagement, and brand promotion.

50. Bumisita kami sa mga kaibigan namin sa kanilang bahay sa hatinggabi.

Similar Words

newspapers

Recent Searches

newsika-12tutusincultivationmasaktanpagbigyangospelumuulanfavorbanalmaskinerpagbatisarisaringmbricoskarapatangguerrerokamicalidadumigibnagdaosbibilhinvelfungerendemartianarturoejecutaninalagaanimbeswinsmagsaingnapakonahulogtawahumblepaskongpadabogshinesmagbigayangiverpebreropagputiroonterminobalingleukemiadoktornyamatandaespigasmest4thshapingdidbiggestfrieskaringmaaringprobablementeclearumilinglabananlcdpinalakingcontinueskarnabalochandoreturneddifferentconditionlasinggraduallyinvolvedigitalmasrolledahhpalitanpagkakataongverden,sensiblepasensyarelomananahiroleernanconditioningwaymagawangpaslitnabiawangnatutuwapinaulananpollutionhouseholdfauxpagmasdanginaganoonreportermagalingilocoslumutangdarkharapanrevolutionerethinatidpatienceothersspareparkepaskomapagbigaypilipinasgalitistasyonnakikitangbrancher,butikipagsasalitavidtstraktcualquiermaghaponisinagotmarketingnasaasopinoykanyalakaspagbabantakasaysayanpulismabaitlalakekumbentotibigmisteryonakasandigdekorasyonpodcasts,ikinakagalitnakakatawasulingantuwidbulsabelievedmalapitcomeinsteadattackcertainpilingbetaulingnapakahanganinongtinataluntonumagawsagutinmaintindihanmakawalacarmennobodymagpakaramikaliwamahalgasmenmenssikatpesonagsimulatayobihiranapilitangbalinganfederalcompletamenteadmiredpatientkargangtulangdumilimupuanfriendkinsesumigawcoalhopeaffiliatewasteiilansinumangdiscoveredlikestagalogmangedulotsenateanimoytsepanayminuto