Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "news"

1. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

2. Bawal magpapakalat ng mga fake news dahil ito ay nagdudulot ng kaguluhan at kawalan ng tiwala sa media.

3. Before the advent of television, people had to rely on radio, newspapers, and magazines for their news and entertainment

4. He maintained a contentious relationship with the media, frequently referring to some outlets as "fake news."

5. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

6. I fell for an April Fool's joke on social media this year - a friend posted a fake news article that was so convincing I thought it was real.

7. Laganap ang fake news sa internet.

8. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

9. Receiving good news can create a sense of euphoria that can last for hours.

10. Sa ganang iyo, dapat bang palakasin pa ang kampanya laban sa fake news?

11. The "News Feed" on Facebook displays a personalized stream of updates from friends, pages, and groups that a user follows.

12. The news might be biased, so take it with a grain of salt and do your own research.

13. The stock market can be influenced by global events and news that impact multiple sectors and industries.

14. The traffic on social media posts spiked after the news went viral.

15. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

16. Twitter is known for its role in breaking news and providing a platform for public discussions and debates.

Random Sentences

1. Las hojas de mi cuaderno están llenas de garabatos y notas.

2. Pakibigay ng malakas na palakpak ang lahat para sa ating mga guro.

3. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

4. Jeg har været forelsket i ham i lang tid. (I've been in love with him for a long time.)

5. Adopting a pet from a shelter can provide a loving home for an animal in need.

6. I need to check my credit report to ensure there are no errors.

7. She had been studying hard and therefore received an A on her exam.

8.

9. Pumitas siya ng isang bunga at binuksan iyon.

10. Madalas akong matulog sa silid-aralan dahil boring ang paksa.

11. Ikaw ay magiging isang nilalang sa karagatan.

12. Su obra también incluye frescos en la Biblioteca Laurenciana en Florencia.

13. Emphasis can be used to provide clarity and direction in writing.

14. Sa panahon ng pandemya, yumabong ang paggamit ng mga online platforms para sa mga transaksiyon.

15. Inakalang walang interesado sa kanyang alok, pero marami ang tumawag.

16. Juan siempre espera el verano para cosechar frutas del huerto de su abuela.

17. Umabot sa hukuman ang panaghoy ng mga biktima ng kalamidad para humingi ng hustisya.

18. Viruses are small, infectious agents that can infect cells and cause diseases.

19. Labis kang nasugatan, mabuti pa siguro ay sumama ka sa akin upang magamot ng aking asawa ang iyong mga sugat.

20. I finally finished my degree at age 40 - better late than never!

21. Ikaw ang magnanakaw! Amin yan! Nasa ref ng bahay ko!

22. She found her passion for makeup through TikTok, watching tutorials and learning new techniques.

23. Ang sugal ay naglalabas ng mga salarin na nagpapayaman sa pamamagitan ng pag-aabuso sa mga manlalaro.

24. Stephen Curry revolutionized the game with his exceptional three-point shooting ability.

25. Ang panayam sa radyo ay ukol kay Doktor Jose Rizal na tumulong sa mahihirap.

26. Nakinig ang mga estudyante sa guro.

27. Inflation kann auch durch eine Erhöhung der Arbeitskosten verursacht werden.

28. The patient was diagnosed with leukemia after undergoing blood tests and bone marrow biopsy.

29. Sa loob ng sinehan, nabigla siya sa biglang pagsabog ng surround sound system.

30. Akala ko nung una.

31. Investors can invest in a variety of asset classes, such as stocks, bonds, real estate, and commodities.

32. La creatividad es una habilidad que se puede desarrollar con la práctica y el esfuerzo.

33. Hindi niya agad napansin ang sugat hanggang sa sinubukan niyang salatin ito.

34. "May sorpresa ako para sa’yo," ani ng tatay sa kanyang anak.

35. Bawal mag-abuso ng kapangyarihan dahil ito ay isang krimen.

36. El muralismo es un estilo de pintura que se realiza en grandes superficies, como muros o paredes.

37. Ang aming kaharian ay hindi kayang marating ng taong may katawang lupa.

38. Hindi ko kinuha ang inyong pitaka.

39. Dyan ka lang ha! Wag kang lalapit sakin!

40. Ang pagkakaisa ng buong nayon sa panahon ng krisis ay lubos na ikinagagalak ng kanilang lider.

41. Mahalaga na magtulungan tayo upang maabot ang ating mga pangarap bilang isang grupo o komunidad.

42. Sa mga hayop, ang hudyat ay maaaring gamitin sa pakikipag-ugnayan, tulad ng pagpapakita ng kilos ng buntot o ng mata.

43. Pahiram ng iyong mga notepads at ballpen para sa aking meeting.

44. Nationalism can also lead to xenophobia and prejudice against other nations and cultures.

45. Sa tuwing may malaking okasyon, ginaganap ang ritwal ng pagtawag sa mga ninuno upang humingi ng gabay.

46. Las personas pobres a menudo carecen de recursos para protegerse de desastres naturales y crisis.

47. People experiencing baby fever may find themselves daydreaming about pregnancy, childbirth, and the joys of raising a child.

48. Siguro ay may kotse ka na ngayon.

49. Naiinlove ako nang lubusan sa aking nililigawan dahil napakasaya ko tuwing kasama ko siya.

50. Palagi niyang suot ang kanyang korona upang ipakita na siya ay makapangyarihan.

Similar Words

newspapers

Recent Searches

newsindustriyamakakaadvancementguerrerohalasigasiamabutibinanggatokyolunesnagngangalangseekinulitmarmaingbastonprogramssumapitmagkikitaopdeltpakikipagtagpomakapaibabawpinagtagpocontentbangladeshhumalakhakandroideskwelahanpinagalitankayabangantog,nagpuyosnakainnatanongmuntikansayaofrecennapakaumakyatpitumpongbrasoisisingitmahirappebreronagpasyasuelopalaginatalongaabotsettingcountlessbuslopesosinkneedcomunesnapapasayatravelernanlilimahidnagbanggaanmakapagbigaymedisinapangyayaricrucialunahintatloseennagbabagakasiyahanmakipagkaibiganmagtataasleksiyonnagpabotnahintakutanromanticismotawagunattendedpssspagkaangatpahirammawawalanatiraadgangtv-showspamasahenakapagproposetungkodincluirkulunganpapagalitanmahigitkanilakaraokelikodmatumalmerchandisesumasaliwkamisetangfitnesstawanankinalimutaninstitucionesrestawranparoroonasakimtiyanmisteryoyumaostyrerincreasedataquesactinggametusindviskasoynaturalbagalphilosophicallaborterminonyaspentsponsorships,iniuwimagta-trabahounti-untidisenyongnalalabimakitakasangkapannakaka-inlumikhadekorasyonumiyakmagkaibaturismopagpuntabumisitatinangkabowlkagipitanpinag-aaralanheldtumaholpahahanapmarketing:iniibignasankasaysayanincidencepaidpabulongjingjingenviarisinuotvivaeksempelmahahawakaliwatssspag-asabansanghuwebesmalamangconsumemakahinginuhbateryasolidifysancongressleokantotransmitssinimulanfauxexpectationsintotwinklestrengthpingganpinalutocommissionerrors,ipapahingarougharea4theyekartonkinabubuhaynakalagaymakauwinakahugkusinerolungkotiikutanimpactotinuturo