Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "news"

1. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

2. Bawal magpapakalat ng mga fake news dahil ito ay nagdudulot ng kaguluhan at kawalan ng tiwala sa media.

3. Before the advent of television, people had to rely on radio, newspapers, and magazines for their news and entertainment

4. He maintained a contentious relationship with the media, frequently referring to some outlets as "fake news."

5. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

6. I fell for an April Fool's joke on social media this year - a friend posted a fake news article that was so convincing I thought it was real.

7. Laganap ang fake news sa internet.

8. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

9. Receiving good news can create a sense of euphoria that can last for hours.

10. Sa ganang iyo, dapat bang palakasin pa ang kampanya laban sa fake news?

11. The "News Feed" on Facebook displays a personalized stream of updates from friends, pages, and groups that a user follows.

12. The news might be biased, so take it with a grain of salt and do your own research.

13. The stock market can be influenced by global events and news that impact multiple sectors and industries.

14. The traffic on social media posts spiked after the news went viral.

15. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

16. Twitter is known for its role in breaking news and providing a platform for public discussions and debates.

Random Sentences

1. Holy Week begins on Palm Sunday, which marks Jesus' triumphal entry into Jerusalem and the start of the Passion narrative.

2. Kailangan mong matuto ng pagsusuri upang mas maintindihan ang kaibuturan ng isang sitwasyon.

3. "The more people I meet, the more I love my dog."

4. Ano bang nangyari? tanong ni Lana.

5. Dahil sa pagtatapos ng isang mahabang relasyon, siya ay puno ng lungkot at panghihinayang.

6. Sa paligid ng bundok, naglipana ang mga ibon na nagpapaganda sa tanawin.

7. Las escuelas promueven la inclusión y la diversidad entre los estudiantes.

8. Ako ngayo'y lumilipad at nasa langit na.

9. You need to pull yourself together and face the reality of the situation.

10. Sweetness can also be found in natural sweeteners, such as honey and maple syrup.

11. Uwi na tayo.. Ayoko na dito sa ospital..

12. Ang tubig-ulan ay maaaring magdulot ng pagkakasakit kung hindi magiging maingat sa pag-inom nito.

13. Pigain hanggang sa mawala ang pait

14. Sa kaibuturan ng kanyang pagkatao, mahal niya ang pamilya niya.

15. Hindi ka ba napaplastikan sa sarili mo, tol?

16. Les patients sont souvent admis à l'hôpital pour recevoir des soins médicaux.

17. Ibinenta ni Mang Jose ang karne kay Katie.

18. Ang blogger ay nagsusulat ng mga blog post upang ibahagi ang kaniyang mga opinyon at karanasan.

19. Anak, iwasan mo si Don Segundo, baka ikaw ay mapahamak, pagpapaalaala ng nangangambang ina.

20. May mga taong may agam-agam sa mga pangarap nila sa buhay kung ito ba ay magkakatotoo o hindi.

21. The meeting was cancelled, and therefore he had the afternoon off.

22. Off the court, LeBron is actively involved in philanthropy through his LeBron James Family Foundation, focusing on education and providing opportunities for at-risk children.

23. Leukemia can be acute or chronic, depending on how quickly the disease progresses.

24. Pigilan nyo ako. Sasapakin ko talaga 'tong isang 'to.

25. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

26. Bilang paglilinaw, hindi ako nagsabi na aalis ako, kundi lilipat lang ako ng departamento.

27. Les travailleurs peuvent travailler dans une variété de domaines tels que la finance, la technologie, l'éducation, etc.

28. The king's coronation is a ceremonial event that officially marks his ascension to the throne.

29. Hindi ko kinuha ang inyong pitaka.

30. Nanalo siya ng sampung libong piso.

31. Foreclosed properties are homes that have been repossessed by the bank or lender due to the homeowner's inability to pay their mortgage.

32. All these years, I have been overcoming challenges and obstacles to reach my goals.

33. Kailangan mong higupin ang gamot gamit ang straw.

34. Binabasa niya ng pahapyaw ng kabuuan ng seleksyon at nilalaktawan ang hindi kawili-wili

35. Napaluhod nalang siya sa harap ng palasyo at umiyak.

36. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

37. He does not argue with his colleagues.

38. "You can't teach an old dog new tricks."

39. Skærtorsdag mindes Jesu sidste nadver med sine disciple, før han blev taget til fange.

40. Natuwa ang binata sa kanya at nagwikang "Magandang umaga din sa iyo"

41. Lumiit ito at nagkaroon ng mga mahahabang paa.

42. Bakit siya pa yung kelangan mong pahirapan?

43. Ate Annika! Gusto ko yung toy! Gusto ko yung toy!

44. Il est également important de célébrer les petites victoires en cours de route pour rester motivé.

45. Hinawakan ko siya sa may balikat niya.

46. Hindi dapat natin pahintulutan ang paglapastangan sa kapakanan ng mga batang nasa mapanganib na kalagayan.

47. Tila may pagdududa siya sa katapatan ng kanyang kaibigan.

48. Ginising ko si Cross, Oy gising. Umaga na.

49.

50. Dahil dito ang mga tao ay laging may mga piging.

Similar Words

newspapers

Recent Searches

newsumikotsuccesscultureslumusobgelaipinalambothinahaplosmatutongmaaksidentetirangikatlongkassingulanglalargamatutulogflamencobibilhincoughingpulongminahanlalimlagaslasisubonaglulutokapwabinibiligagambawaitertondokabarkadapersongownmabutibulonghapagtrajeanasusiambagculpritaddictionejecutantulangsapilitangubosumakaynuhrevolutionizedkinantaninongcnicomaingatmanghulimerrymaestromustmapaibabawjoepetsangcassandratinionakatingingteachingsaplicafriessuelopedebiggestproducirreservationtherapylightssabihingbasahanginangdidlayunindenpdamagkakaroonexpertballkararatingfuncionesnagbibirofourtaon-taonnamungacontinuedboxreadingleftendtelevisedfredspeechdibdibmulingreturnedconditioninaapiinternainvolveclassmatefallakarganglolonakakabangonmakasamakaarawanpagsisisielviskampoiloilotignandespuess-sorrydumilatberkeleynagreklamomatakawfatalmaglabadolyarbubongbalancesmakapagsalitalookedtiyancocktailpagkaingindependentlyganunturonlabahinmauntogumigibpagpapatubonagpapaigibmovieshinagud-hagodnagsusulatsponsorships,geologi,pinagtagponakikitabinigyangso-calledresearch:bluedagaatinkamatiseventsproperlypinyaasulpayokasimensajessaangnagpalalimnananaloeskwelahanpaghalakhakpinakamatabangnaka-smirkkumakalansingbaranggayobviousmaliwanagbisitalumakaspangangatawannagbantaykalalaromakikiligoi-rechargenageespadahantaosnagtataemasasabikaibiganpagbigyannareklamonami-missyumuyukodaigdignanamanlumindolisusuotnatanongmasaktantumaposhahahakangitanalmacenarbinabaliktiliroofstock