Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "feedback,"

1. It can be helpful to get feedback from beta readers or a professional editor

2. Reinforcement learning is a type of AI algorithm that learns through trial and error and receives feedback based on its actions.

3. Representatives often hold regular meetings or town halls to connect with their constituents and gather feedback.

4. Seek feedback, it will help you to improve your manuscript

5. The website has a section where users can leave feedback and suggestions, which is great for improving the site.

Random Sentences

1. Ito ang nabigkas ni Waldo, mga katagang mula sa kanyang puso na punong-puno ng hinanakit.

2. Masarap ang pagkakaluto mo ng kare-kare.

3. Mahalagang mag-ingat sa ating kalusugan, datapapwat ay hindi natin nakikita ang mga mikrobyo at virus na nagdadala ng sakit.

4. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

5. Sabay sabay na nagtanghalian ang mga estudyante sa canteen.

6. Mataas sa calcium ang gatas at keso.

7. Ang sampaguita ang pambansang bulaklak ng Pilipinas.

8. Ano ang gustong sukatin ni Merlinda?

9. Pinabulaanang muli ito ni Paniki.

10. Nilalakad namin ang mapa para mahanap ang aming pupuntahan.

11. Madalas syang sumali sa poster making contest.

12. "A dog's love is unconditional."

13. Palibhasa ay madalas na nagsusulong ng mga bagong ideya at mga panukala dahil sa kanyang malawak na pananaw.

14. Ang panitikan ay nagpapahayag ng mga damdamin at karanasan ng mga tao.

15. Mag-babait na po siya.

16. Los blogs y los vlogs son una forma popular de compartir información en línea.

17. Nakakamangha ang paglalagay ng pulotgata sa bao ng niyog upang makagawa ng kakanin.

18. Bakit lumilipad ang manananggal?

19. Naidlip siya at nang magising, nakita niya ang magandang dilag.

20. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

21. Lumipad palayo ang saranggola at hindi na nila nakita.

22. Ada berbagai jenis kucing yang ada di Indonesia, seperti kucing Persia, Siamese, dan Scottish Fold.

23. My son drew a picture of a pretty lady with a big smile.

24. Instagram also supports live streaming, enabling users to broadcast and engage with their audience in real-time.

25. Maganda ang pakiramdam kapag mayroon kang kaulayaw na makakasama sa buhay.

26. Ako naman, poker face lang. Hahaha!

27. Emphasis is the act of placing greater importance or focus on something.

28. Unfortunately, Lee's life was cut short when he died in 1973 at the age of 32

29. Mathematics can be used to analyze data and make informed decisions.

30. Mens nogle mennesker nyder gambling som en hobby eller en form for underholdning, kan det også føre til afhængighed og økonomiske problemer.

31. La paciencia es necesaria para alcanzar nuestros sueños.

32. Off the court, LeBron is actively involved in philanthropy through his LeBron James Family Foundation, focusing on education and providing opportunities for at-risk children.

33. Alas-tres kinse na ng hapon.

34. The patient was referred to a specialist in leukemia treatment for further evaluation and care.

35. Ang talento ng mga Pinoy sa pagkanta ay hinahangaan sa buong mundo.

36. Mathematics helps develop critical thinking and problem-solving skills.

37. Papanhik din sana siya sa tuktok ng burol subalit naabot siya ng rumaragasang tubig-ulan na lalong nagpalalim sa dagat-dagatan.

38. Nous allons nous marier à l'église.

39. The dedication of scientists and researchers leads to groundbreaking discoveries and advancements in various fields.

40. Ganun ba? Sige samahan na lang muna kitang maghintay dito.

41. El perro de mi amigo es muy juguetón y siempre me hace reír.

42. Medical technology has also advanced in the areas of surgery and therapeutics, such as in robotic surgery and gene therapy

43. "A dog is the only thing on earth that loves you more than he loves himself."

44. If you quit your job in anger, you might burn bridges with your employer and coworkers.

45. The uncertainty of the future can cause anxiety and stress.

46. Sa mula't mula pa'y itinuring na siya nitong kaaway.

47. Tumango tapos nag punta na kami sa may garden ng hospital.

48. Algunas serpientes son conocidas por su capacidad para camuflarse en su entorno, lo que les permite acechar a sus presas de manera efectiva.

49. El teatro experimental presenta una interpretación sublime del teatro moderno.

50. Napatigil siya bigla at nabitawan yung kamay ko.

Recent Searches

reorganizingfeedback,galitngamatabagrowthenternamumukod-tanginagkasunoguncheckedskillsmulti-billionuugod-ugodfacilitatingsasabihintakesagingipipilitthoughtstechnologiestumatakbopatunayankasamahuhdresspakainnotincludingpresidentkristokayfelttiranteperonaghandangdetgalawstuffedcampaignsmapilitangnightgirlkisshinanakitwidespreadchickenpoxkusinapaglalayagriegadiliginanalyseipinadalatenemocionantekinabibilangansalatinoftematumalnakakabangonbumotobelievedpangulonatigilanscientificpakinabangankantokagubatanparinlivedikyamikinakagalitiiwasanneropagsambanearmakahiramhumpayteknologinamataylikodvelstandpopularviolencekumitasystemlulusoghundredinabutanantoktaglagasmakikipaglaropingganmalasutlasharklingidpinyaiyamotstrengthrosapinakamaartengtignaneventatanggapinrepublictamanapakahabaumagaunconstitutionalpilipinosandaliiwananmagamotnaglokojuniomillionskapilingfireworksnapakabiliscualquiersubalitencounterreplacedtechnologicalpag-ibigmonetizingnapapadaancubicleboksingstyreraudio-visually00amcandidatelegislativeganapingiitfederalismtanongkoreankabighamasamanggandahanflymahiwagaipinanganakdamitwaiterkuyaitinatagseasonharapmamitasdibdibmasipagjackcurrentkomunikasyonjenatabidawtuklastinangkangtinatawagnaiyaklaruingaanotwinklehumanostaga-nayoninilistahiwaheiniyanmaidganitoochandobabyredbeastnovembermagawahangaringiikliburolmaispambatangmurang-muraaga-agamagbantaykabutihantsinamagkaparehonakakaenpitohalu-halomalakasfranciscobumabahatawaryanpatuloy