Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "magdoorbell"

1. Magdoorbell ka na.

Random Sentences

1. If you spill the beans, I promise I won't be mad.

2. Los agricultores pueden desempeñar un papel importante en la conservación de la biodiversidad y los ecosistemas locales.

3. He has written a novel.

4. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

5. Anung oras na ba? bakit hindi pa kayo naalis.

6. Pumitas siya ng bunga at pinisil ito hanggang sa lumabas ang laman.

7. Uno de los festivales de música más importantes de España es el Festival de San Sebastián, que se celebra en septiembre y cuenta con la participación de artistas de renombre internacional

8. Naisip nilang tinangka ng kanilang anak na sunugin ang kanilang bahay.

9. Naglinis kami ng bahay noong Linggo.

10. The momentum of the protest grew as more people joined the march.

11. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

12. Inabot ko naman yung pinggan. Anim na hotdog ang nandun.

13. Marami pa siyang mga pangarap sa buhay at kailangan ko pa po siya.

14. Tanah Lot di Bali adalah sebuah pura Hindu yang terletak di atas karang dan menawarkan pemandangan laut yang indah.

15. Ayaw ko magtangkang magbiyahe nang walang mapa.

16. Sa bus na may karatulang "Laguna".

17. Pinaliguan ni Simon ang sanggol.

18. At minamadali kong himayin itong bulak.

19. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

20. Napakaganda ng mga pasyalan sa bansang Japan.

21. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

22. Nagulat siya ng makita niya ang isang usa na malapit ng kainin ng isang tigre.

23. Two heads are better than one.

24. Aus den Augen, aus dem Sinn.

25. I am absolutely confident in my ability to succeed.

26. Ang sakit ng kalingkingan ay ramdam ng buong katawan.

27. Sa lahat ng bagay, mahalaga ang tamang panahon.

28. Nasa likod ng aking bahay, natatanaw ko ang bukid na puno ng sariwang mga halaman.

29. Sa tagal nilang nagsama ay hindi sila pinalad magkaroon ng anak

30. La música puede ser una forma de protesta y expresión de descontento.

31. Pag-akyat sa pinakatuktok ng bundok.

32. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

33. He has learned a new language.

34. Cryptocurrency operates independently of central banks and governments.

35. Alam kong parang biglaan, pero sana pwede ba kita makilala?

36. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

37. Napakabagal ng proseso ng pagbabayad ng buwis, animoy lakad pagong.

38. Tak ada gading yang tak retak.

39. Musk has been at the forefront of developing electric cars and sustainable energy solutions.

40. The first mobile phone was developed in 1983, and since then, the technology has continued to improve

41. Ngunit isang araw ay naubos na ang pasensiya ni Perla at nagalit kay Amparo na laging nagrereklamo sa kanilang ulam.

42. The dancers are not rehearsing for their performance tonight.

43. The United States has a system of federalism, where power is divided between the national government and the individual states

44. Nogle lande og jurisdiktioner har lovgivning, der regulerer gambling for at beskytte spillerne og modvirke kriminalitet.

45. The restaurant was full, and therefore we had to wait for a table.

46. She has been cooking dinner for two hours.

47. Nationalism can be both a positive force for unity and a negative force for division and conflict.

48. Las personas pobres a menudo viven en condiciones precarias y carecen de seguridad económica.

49. We have visited the museum twice.

50. Me siento caliente. (I feel hot.)

Recent Searches

magdoorbellmahuhulipunong-punonag-isipabalangjacexviicaraballobookgrowthgusgusingdiliwariwemailsaberanumanmakukulaymayroonglumilingonbarcelonaheichangehumaloconditioningcreatingpaskokapilingulamtaon-taondawkailanmanawatungoipinagbibilinanghuhulipinagalitanpaksamagbubungaplaysmatagumpaynapakatagalmaynagkakamalivirksomhederpamilihanbutikikampoeconomicseryosonglintahitikmaskaracedulatotoonamumutlabagsakvariousbeenkasuutannaritosparkbandapaldasellingotherssumimangotdiseasesbumangontamadpampagandakawalnagniningninginspirationde-latanaawasunud-sunodhiramrespektivemagalitpromoteanak-pawisburdenanimobuwalideasfeelspeechesunderholderkatabingstillnagtatakbogayunpamannagkakatipun-tipondaratingnakalilipaslumiwanageskwelahankumbinsihinmagbibiyahenakikilalangmakakasahodmoviespagmamanehopossiblepagkapasokinakalangnageespadahankumikinigbloggers,palabuy-laboylumakaskinasisindakanpresidentekabutihansharmainesagasaanatensyonginjurypagongkargahankinakainkarapatangtienennaguusapnatanonggelaihabangespadapagbebentacompaniesiniindapaidpartsinakalanagpalutoplatomaawaingmagbibiladkaninumankomedortotoongartistpawiinmahiyade-dekorasyonricahuertobibilhinlalimnapakaipinambilisumasakaywakaspangalananstreamingtsakagabrielpogikapainpasensyaalaskalongsumisidhoymag-anakkinantaumanosanmagdanakaka-incenternumerosasipaliwanagredigeringhmmmmtanodnakapuntanalungkotencuestasgeneratebosesballluisenchantedinalalayantatayonathancadenaconditioninfinityelectmulingpowersmonetizingcablemichaelnasundopagkaraanlearningulinglibro