Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "improved"

1. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

2. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

3. He has improved his English skills.

4. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

5. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

6. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

7. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

8. Quitting smoking can also lead to improved breathing, better oral health, and reduced risk of premature aging.

9. Smoking cessation can lead to improved mental health outcomes, such as reduced anxiety and depression symptoms.

10. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

11. The foundation's charitable efforts have improved the lives of many underprivileged children.

12. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

13. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

Random Sentences

1. Smoking is influenced by various factors, such as peer pressure, stress, and social norms.

2. Hindi pa rin makapagsalita si Mang Kandoy.

3. Nandiyan po ba si Ginang de la Cruz?

4. Sí, claro, puedo confirmar tu reserva.

5. Makikita mo sa google ang sagot.

6. Påsketiden er en mulighed for at tilbringe tid sammen med familie og venner og nyde det forårsagtige vejr.

7. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

8. nakita niya ang naghuhumindig na anyo ni Ogor.

9. Ang utang ay nangangahulugan ng pagkakaroon ng obligasyon na magbayad ng isang halaga sa isang tiyak na panahon.

10. The photographer captured the essence of the pretty lady in his portrait.

11. You may now kiss the bride. Sabi nung priest.

12. Haha! I'd want to see you fall inlove tonight.

13. Si Mabini ay isa sa mga pinakamatatalinong lider sa panahon ng himagsikan sa Pilipinas.

14. Her music career took off with her debut album Yours Truly in 2013, featuring the hit single "The Way."

15. Smoking can cause various health problems, including lung cancer, heart disease, and respiratory issues.

16. La música que produjo el compositor fue muy innovadora para su época.

17. Seeing a long-lost friend or family member can create a sense of euphoria and happiness.

18. Ang daming pusa sa bahay nila Jocelyn.

19. La tos puede ser un síntoma de afecciones menos comunes, como la sarcoidosis y la fibrosis pulmonar.

20. Landbrugsprodukter, især mejeriprodukter, er nogle af de mest eksporterede varer fra Danmark.

21. Naririnig ko ang malakas na tunog ng ulan habang ako ay tulala sa bintana.

22.

23. Nag-aral kami sa library kagabi.

24. Sweetness can evoke positive emotions and memories, such as childhood nostalgia.

25. Inalis ko yung pagkakayakap niya sa akin. At umupo sa sofa.

26. Kailan ipinanganak si Ligaya?

27. Una dieta equilibrada y saludable puede ayudar a prevenir enfermedades crónicas.

28.

29. Es ist wichtig, ehrlich zu sich selbst zu sein, um eine gute Gewissensentscheidung treffen zu können.

30. We admire the dedication of healthcare workers in the midst of the pandemic.

31. En México, el Día de los Enamorados se celebra con una fiesta tradicional llamada el Día del Cariño.

32. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

33. Masanay na lang po kayo sa kanya.

34. Ano ang binibili ni Consuelo?

35. Nagitla ako nang biglang bumagsak ang mga plato sa kusina.

36. Ang kanilang kaharian ay malapit sa isang maliit na gubat na kung saan ay malayang nakakapamasyal ang mayuming kagandahan.

37. Inakalang masaya siya, pero sa likod ng ngiti ay may lungkot.

38. Sa mga tunog ng kundiman, nabibigyang-buhay ang mga kuwentong umiikot sa pag-ibig at pagdurusa.

39. People experiencing baby fever may find themselves daydreaming about pregnancy, childbirth, and the joys of raising a child.

40. En invierno, las actividades al aire libre incluyen deportes de invierno como el esquí y el snowboard.

41. Ang buhawi ay maaaring magdulot ng pagkalbo sa mga puno, pagbagsak ng mga poste ng kuryente, at iba pang pinsala sa imprastruktura.

42. It is brewed from roasted coffee beans, which come from the Coffea plant.

43. Eksport af tøj og beklædningsgenstande fra Danmark er også stigende.

44. Ipaghanda mo si Lina ng Maghanda ka ng damit

45. Puwede ba siyang pumasok sa klase?

46. Nationalism has been used to justify imperialism and expansionism.

47. She has learned to play the guitar.

48.

49. Kinakailangang kahit paano'y magkaroon tayo ng maihaharap na katibayang siya nga ang dumukot ng inyong kuwarta.

50. Napangiti ang babae at kinuha ang pagkaing inabot ng bata.

Recent Searches

feedbackimprovedtanggapinneveruponbathalaslavesafelangkayrelativelyhimselfendkinakailangantinutopdalitinanggapinaapidraft,producereranikanpaketena-fundphilippinepadalasstarrecentbilerngumingisitodayhousemenunapabayaanpaglalabadalikepagkakatumbapalangtumangosagotsay,sigawadoptedpaglapastanganutilizankerbeducationkastilayakapbiyernesumamponkasyaganoonkagandahannanlilisikkarunungannagsunurannagbabakasyonnakapangasawapagka-maktolcarsmaraminagpabottinaymananakawmahinangmahinoglumakaskalayuannagdiretsokanikanilanghitanakakatabamovieculturalnaabutanlumikhadumilatmaistorbomaghilamosmauupokakutiscultivationinterests,pinalalayasvaccinesnalugodinilistaprimerosmusicalesnagdabogpeksmanisinagotmarurumimagbantayhinamakna-curioussurveysnatitiyakpinipilitiyamotmagsabijeepneypinapakingganpinansinmahaboltagpiangumagangpatawarinpinabulaanganapinpapuntangnanlalamignakakapuntaaustralialaganapnatigilannababalothawlabenefitsuniversitiesgumisingendviderekanayangnagplaymassachusettspisaranuevosiwananisinarayumakapkasintahannagsasabingconvertingdreamslasangisielenaanghelsalesrobinhoodnovemberganunhumigaaregladonandiyanagila3hrscandidateskapaltinaposdedicationimporbinibilanglimitedherramientakatapatcompositoressinakopkamustahikingpamanhagdannoongnatulogphilosophicalpinalayasimbeshinabolsuwailpamilyangritwalonlinemansanasbasahinkatandaanfionamassesprinceparinoutlinemalumbayparkingmalambingbumabahacharismaticedsanahihilonutrientescoinbasestonehamneroconsideredmalaboadvancedhomeworkdatapwatformascoaching:larryespada