Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "house"

1. "A house is not a home without a dog."

2. A couple of cars were parked outside the house.

3. Binigyan si Hidilyn Diaz ng house and lot bilang bahagi ng kanyang mga gantimpala.

4. Congress is divided into two chambers: the Senate and the House of Representatives

5. Hansel and Gretel find themselves lost in the woods and stumble upon a gingerbread house owned by a wicked witch.

6. Have they finished the renovation of the house?

7. He has painted the entire house.

8. Malaki ang kanilang rest house sa Tagaytay.

9. Sa Taal, Batangas matatagpuan ang Mabini Ancestral House na pinaniniwalaang bahay-bata ni Apolinario Mabini.

10. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

11. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

12. They are cleaning their house.

13. They are not cleaning their house this week.

14. They clean the house on weekends.

15. They have been renovating their house for months.

16. They have bought a new house.

17. They have sold their house.

18. This house is for sale.

19. We have been cleaning the house for three hours.

20. We have cleaned the house.

21. We should have painted the house last year, but better late than never.

Random Sentences

1. Hindi naman sa ganun. Kaya lang kasi...

2. Las personas pobres a menudo carecen de recursos para protegerse de desastres naturales y crisis.

3.

4. Les entreprises cherchent souvent à maximiser leurs profits.

5. En mi tiempo libre, aprendo idiomas como pasatiempo y me encanta explorar nuevas culturas.

6. Bago pa man maghatinggabi ay dumating nga ang prinsipe at lubos na nalugod ang nag-aalalang prinsesa.

7. Wonder Woman wields a magical lasso and bracelets that can deflect bullets.

8. Ang mga indibidwal na may marahas na asal ay maaaring humantong sa pagkakasangkot sa legal na problema.

9. Pagkatapos ng ulan, naging maaliwalas ang kapaligiran.

10. Hindi niya gustong maging nag-iisa sa pagpaplano ng kanyang kinabukasan.

11. Di rin ako paulit-ulit ha! Di yan ang lagi kong sagot!

12. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

13. Kanser ang ikinamatay ng asawa niya.

14. Pinuri umano ng mga eksperto ang bagong teknolohiyang inilunsad ng mga siyentipiko.

15. Hulk is a massive green brute with immense strength, increasing his power the angrier he gets.

16. Women have made significant strides in breaking through glass ceilings in various industries and professions.

17. Ipinabalot ko ang pakete sa kapatid ko.

18. Wer zuletzt lacht, lacht am besten.

19. Ang magsasaka ay nagtatanim ng palay sa bukid.

20. Hospitalization can be expensive, and patients may be responsible for paying for medical bills and other associated costs.

21. Television has a rich history, and its impact on society is far-reaching and complex

22. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

23. I know I should have gone to the dentist sooner, but better late than never.

24. Ang pagkapanalo ng koponan ay siyang ikinagagalak ng lahat ng sumuporta sa kanila.

25. The traffic on social media posts spiked after the news went viral.

26. Nagkantahan kami sa karaoke bar.

27. Langfredag ​​mindes Jesus 'korsfæstelse og død på korset.

28. Oscilloscopes can measure not only voltage waveforms but also current, frequency, phase, and other parameters.

29. Når man bliver kvinde, er det vigtigt at have en sund livsstil og pleje sit helbred.

30. Hinde pa naman huli ang lahat diba?

31. Bago umalis ng bahay, isinasagawa niya ang ritwal ng pagdarasal upang maging ligtas sa biyahe.

32. Mabilis manakbo ang aso ni Lito.

33. I just launched my new website, and I'm excited to see how it performs.

34. Sa pagtulog, ang katawan ay nagpapalakas at nagpaparegla ng mga proseso nito.

35. Les personnes ayant des antécédents de dépendance ou de problèmes de santé mentale peuvent être plus susceptibles de développer une dépendance au jeu.

36. Cosechamos los girasoles y los pusimos en un jarrón para decorar la casa.

37. Naaksidente si Juan sa Katipunan

38. They have been volunteering at the shelter for a month.

39. Nahuli ang salarin habang nagtatago sa isang abandonadong bahay.

40. Beyoncé is a highly acclaimed singer, songwriter, and actress known for her powerful performances and chart-topping hits.

41. The phone rang late at night, and therefore she was hesitant to answer it.

42. Sa ganang iyo, sapat ba ang paghingi niya ng tawad upang mapatawad ng lahat?

43. Wala ho akong dinukot na maski ano sa kanya.

44. Gusto kong mamasyal sa Manila zoo.

45. Limitations are the boundaries or constraints that restrict what one can or cannot do.

46. The news might be biased, so take it with a grain of salt and do your own research.

47. Paki-translate ito sa English.

48. Hinintay lamang niya ang aking pagdating.

49. Baka nga si Amba pa gumawa ng tela aniya.

50. Min erfaring har lært mig, at det er vigtigt at have en god arbejdsetik.

Similar Words

householdsJailhousehousehold

Recent Searches

housenatuloykanamabaitngpuntahigaasindagatboyetkwebangwidefuryprimerasmesangmasdanulamnothingrelativelygrabestudiedinisauditlabanjeromeuponkitblessrawboxsquattercouldbitawanlittlenagpapaigibmasyadongthanksgivingkirotbalediktoryandevelopsettingtipdumaramiandyinterviewinggoingbroadcastsrebonagre-reviewtobaccopinaoperahanbibisitacreatedpaki-drawingmamataangruposimbahanlalakingsumpaintaga-lupangeyabatangayonharapanhojaswalkie-talkiepinagkaloobanmakapangyarihannagreplyginugunitananghihinamadkinatatalungkuangnamumukod-tangiriskpronouniintayinnaglakadnangangaraltinangkaaanhinmapakalikatawangpagtataposalas-diyesmarielnangahaspalaisipanmovienahintakutanmahahaliktatagalexhaustionkalaunanmakakakaenkabundukanilalagayintensidadmamalasmagandangsumusulatpambatangmakukulayhimihiyawenglishmaghahatidlumindolinilabasmasaganange-bookspakukuluanhinihintayberegningerinuulampaglulutopuntahanbinitiwantumindigiyamotbahagyananamanpalasyobibigyannagyayangpagdiriwangbayadsilid-aralanpinisilparaanghinilaligayapumikitkuliglighinalungkatmbricosniyogminerviekainannapahinanapbestfriendnatigilansarongtransportvegasgrocerybinabaratricoprosesotomorrowmadalingmisteryoalinmamarildialledpnilitomfattendepokerpitumpongabangansumingitkamustalayawbrasoinfluencesparehasracialpaglalaitmerecornerandamingbinigayremaintomarpeaceuntimelynatalongbuslokapetransmitsmagbubungaipapahingapinalutolaborworkdaypaglayasviewsplanniyangmagpapakabaittsinelastumawaartificialpumasoksorrylabananjobshalikaleeentrytechnologyrough