Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "house"

1. "A house is not a home without a dog."

2. A couple of cars were parked outside the house.

3. Binigyan si Hidilyn Diaz ng house and lot bilang bahagi ng kanyang mga gantimpala.

4. Congress is divided into two chambers: the Senate and the House of Representatives

5. Hansel and Gretel find themselves lost in the woods and stumble upon a gingerbread house owned by a wicked witch.

6. Have they finished the renovation of the house?

7. He has painted the entire house.

8. Malaki ang kanilang rest house sa Tagaytay.

9. Sa Taal, Batangas matatagpuan ang Mabini Ancestral House na pinaniniwalaang bahay-bata ni Apolinario Mabini.

10. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

11. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

12. They are cleaning their house.

13. They are not cleaning their house this week.

14. They clean the house on weekends.

15. They have been renovating their house for months.

16. They have bought a new house.

17. They have sold their house.

18. This house is for sale.

19. We have been cleaning the house for three hours.

20. We have cleaned the house.

21. We should have painted the house last year, but better late than never.

Random Sentences

1. Kan du skynde dig lidt? Vi skal nå bussen. (Can you hurry up a bit? We need to catch the bus.)

2. Bakit di mo 'to sinabi sa akin?

3. Sa gitna ng pagdiriwang, naroon pa rin ang kanyang hinagpis na pilit niyang itinatago.

4. Nag smile siya sa akin tapos tumango.

5. Maraming Salamat!

6. Ang monumento ni Mabini ay matatagpuan sa may lalawigan ng Batangas.

7. Sa pamamagitan ng pagkuha ng mahusay na tulog, ang aking pagkapagod ay napawi at nagkaroon ako ng sariwang enerhiya.

8. Quitting smoking can also lead to improved breathing, better oral health, and reduced risk of premature aging.

9. The player who has the ball is called the "offensive player," and the player guarding him is called the "defensive player."

10. Los héroes son personas que enfrentan grandes desafíos y se levantan para superarlos.

11. Algunas culturas consideran a las serpientes como símbolos de sabiduría, renacimiento o incluso divinidad.

12. Pinigilan nya ang mga kamay ko, Wag!

13. L'intelligence artificielle peut aider à améliorer les traitements médicaux et les diagnostics.

14. Dogs are often referred to as "man's best friend".

15. Other parts of the world like Burma and Cuba also cultivated tobacco

16. Musk's innovations have transformed industries such as aerospace, automotive, and transportation.

17. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

18. Hindi ko maintindihan kung bakit niya nangahas na kunin ang bagay na hindi sa kanya.

19. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

20. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

21. Masarap maligo sa swimming pool.

22. Have we missed the deadline?

23. May mga pagkakataon na kinakailangan mong hiramin ang isang sasakyan para sa long-distance travel.

24. Kailangang salatin mo ang tela para malaman kung gaano ito kalambot.

25. Mabuti pa roon, kahit nakabilad sa init.

26. Las drogas pueden tener efectos devastadores en la vida de las personas.

27. Daraan pa nga pala siya kay Taba.

28. She is designing a new website.

29. Doa juga dapat dijadikan sarana untuk memohon perlindungan dan keberkahan dari Tuhan.

30. En España, el cultivo de la vid es muy importante para la producción de vino.

31. Nakasandig ang ulo sa tagpiang dingding.

32. A lot of money was donated to the charity, making a significant impact.

33. Si Juan ay nagiigib ng tubig mula sa poso para sa mga halaman sa hardin.

34. Nagpunta ako sa may lobby para magisip.

35. Mathematics is an essential subject for understanding and solving problems in many fields.

36. The doctor advised him to get plenty of rest and fluids to recover from pneumonia.

37. Sa pamamagitan ng pag-aaral ng kasaysayan, mas naging malalim ang aking kamalayan sa mga pangyayari noong panahon ng Digmaang Pandaigdig II.

38. Ang pagguhit ay isang paraan upang mag-relax at magpakalma.

39. Di ka galit? malambing na sabi ko.

40. Nangagsipagkantahan kami sa karaoke bar.

41. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

42. Hindi niya napigilan ang pagdila sa kanyang labi nang naglalaway siya sa pagkaing inihain sa kanya.

43. He teaches English at a school.

44. Kumaripas ng takbo ang batang may dalang bola nang makita ang kanyang nanay.

45. Børns mentale sundhed er lige så vigtig som deres fysiske sundhed.

46. The Tesla Roadster, introduced in 2008, was the first electric sports car produced by the company.

47. Alam ko pede kang mapagkatiwalaan, Peppy. Kaya please?

48. Cybersecurity measures were implemented to prevent malicious traffic from affecting the network.

49. Ang pagkakaroon ng positibong pananaw ay makatutulong sa pagharap sa mga hamon ng buhay, samakatuwid.

50. Nationalism can be a source of conflict between different groups within a nation-state.

Similar Words

householdsJailhousehousehold

Recent Searches

housefraconventionalpatrickpetsaemphasishomeenchantedkinagalitannamangnagigingbroadhigitmayroonmetodemotionna-suwaypumupuntareaksiyonbinitiwanikinabubuhayiintayinearlycardpinaoperahanipihitballtinakasanintensidadmaka-alisumuwingdesign,tenermasamangkanya-kanyangpangulotupeloinomnagbakasyondogcoachingbasabibisitaeskuwelaharddisciplinvidtstraktnakapagngangalitkapangyarihannagwelgameriendakinabubuhayiniseconomysakristankahuluganvaccinescigarettemalapalasyonamuhaymasasabinapag-alamaniyamotbalik-tanawfysik,masyadongkarapatangoruganahahalinhannakarinignaglulusakpagpalitexcitedlobbymarsonapakaramingnilalangnahawakannaghinalabaryopanalanginmagdoorbellpara-parangempresasingatanpagkagustopuntahanmesamagtrabahomagagandanglaki-lakisuzettekanayangumigibinulitnakabaonroonnuonherramientalumilingoniniibigsteerpagluluksapinagpapaalalahananbawianmanamis-namisnakaliliyongmagpa-checkupbangkangkamiasmalusogsamang-paladnatitiyakginawapigilannatakotmabaitayawhundredmatabangmataraystockskaniyaimagesalas-doserestrestaurantgenehuwagmagkasinggandaclassesipongconnectionmagpaniwalanagtrabahojingjingnaglaholarawantahananvictoriagurokargahandahilkumitapagsalakaymakakasahodsalbahengnapakatalinostrategies1787bagsaknakakatabanagtataepartsnapuyatpakistanmaibibigaypalipat-lipatgarbansospatawarinmilyongkangitannapapayongminahankumaenkutsaritangmawalagustongbihasaboyfriendmartianlakadsiguronangingilidkaninaplacemay-arisiguradopagpuntathroatsuwailmataashangino-orderamericantigassapilitangtulalapublicitylihimgreatlybilanggonapagodsmileangelajobsikipgymbalingan