Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "house"

1. "A house is not a home without a dog."

2. A couple of cars were parked outside the house.

3. Binigyan si Hidilyn Diaz ng house and lot bilang bahagi ng kanyang mga gantimpala.

4. Congress is divided into two chambers: the Senate and the House of Representatives

5. Hansel and Gretel find themselves lost in the woods and stumble upon a gingerbread house owned by a wicked witch.

6. Have they finished the renovation of the house?

7. He has painted the entire house.

8. Malaki ang kanilang rest house sa Tagaytay.

9. Sa Taal, Batangas matatagpuan ang Mabini Ancestral House na pinaniniwalaang bahay-bata ni Apolinario Mabini.

10. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

11. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

12. They are cleaning their house.

13. They are not cleaning their house this week.

14. They clean the house on weekends.

15. They have been renovating their house for months.

16. They have bought a new house.

17. They have sold their house.

18. This house is for sale.

19. We have been cleaning the house for three hours.

20. We have cleaned the house.

21. We should have painted the house last year, but better late than never.

Random Sentences

1. Mommy. ani Maico habang humihingal pa.

2. Kucing di Indonesia sering diberi nama dengan arti yang unik dan lucu.

3. Bawal magpaputok ng mga illegal na paputok dahil ito ay delikado sa kaligtasan ng mga tao.

4. Børns sundhed og trivsel bør være en prioritet i samfundet.

5. Parating na rin yun. Bayaan mo siya may susi naman yun eh.

6. Mainit sa Pilipinas sa buwan ng Abril.

7. Dahil sa magandang boses at musika, nahuhumaling ako sa panonood ng mga musical plays.

8. For nogle kan fødslen være en åbenbaring om styrken og potentialet i deres egen krop.

9. Ipaghugas mo siya ng mga Maghugas ka ng mga

10. Masyado akong matalino para kay Kenji.

11. Kuwartong pandalawahan, hindi ho ba?

12. La labradora de mi primo es muy protectora de la familia y siempre está alerta.

13. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

14. Hindi ko ho makain dahil napakaalat.

15. Scissors are a cutting tool with two blades joined together at a pivot point.

16. Matapos ang kanyang tagumpay, si Hidilyn Diaz ay tumanggap ng maraming parangal mula sa gobyerno at pribadong sektor.

17. Scissors can have straight blades or curved blades, depending on the intended use.

18. They offer interest-free credit for the first six months.

19. Maraming daga ang nahuli ng pusa ni Leah.

20. Sa aking opinyon, isa sa mga magagaling na mang-aawit sa Pilipinas ay si Bukas Palad.

21. Inakalang wala nang pag-asa, pero may dumating na tulong.

22. Mayroong hinahabol na magnanakaw sa kalsada na inaabangan ng mga pulis.

23. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

24. Mayroong nakawan sa bahay namin kahapon, pero aksidente namin naabutan ang mga magnanakaw.

25. Sa kalagitnaan ng pagbabasa, nagitla ako nang biglang mag-flash ang ilaw sa kuwarto.

26. She enjoys cooking a variety of dishes from different cultures.

27. Viruses are small, infectious agents that can infect cells and cause diseases.

28. Natulak ko bigla si Maico nang may magsalita.

29. Ang pagiging malilimutin ni Leah ay dala ng labis na pagkaabala sa trabaho.

30. Walang mahalaga kundi ang pamilya.

31. Gusto ko sanang ligawan si Clara.

32. Lumalangoy ako kapag nasa tabingdagat kami.

33. Happy birthday sa iyo!

34. Naging masaya naman ang dalawa kahit may kondisyon si Cupid na hindi maaaring makita ang kaniyang mukha.

35. Nang maglalabing anim na taon na si Rabona ay may nakita siyang isang pusa sa kagubatan.

36. My brother and I both love hiking and camping, so we make great travel companions. Birds of the same feather flock together!

37. Some viruses can cause cancer, such as human papillomavirus (HPV) and hepatitis B and C.

38. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

39. Di kalaunan, habang lumalaki ang bata, napapansin nilang ito nagiging salbahe, napakasinungaling at maramot.

40. Knowledge is power.

41. The restaurant messed up his order, and then the waiter spilled a drink on him. That added insult to injury.

42. Ipinagbabawal ang marahas na pag-uusap o pagkilos sa paaralan.

43. Nag-aaral ka ba sa University of London?

44. Athena. nagulat siya at bigla niyang pinatay yung monitor.

45. The popularity of coffee has led to the development of several coffee-related industries, such as coffee roasting and coffee equipment manufacturing.

46. Omelettes are a popular choice for those following a low-carb or high-protein diet.

47. Many churches hold special services and processions during Holy Week, such as the Stations of the Cross and the Tenebrae service.

48. Si Hidilyn Diaz ay nagtayo ng weightlifting gym upang suportahan ang mga susunod na henerasyon ng atletang Pilipino.

49. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

50. A los 13 años, Miguel Ángel comenzó su aprendizaje en el taller de Domenico Ghirlandaio.

Similar Words

householdsJailhousehousehold

Recent Searches

housewednesdayminamasdantalekungnasundounconventionalnagkapilattruenagniningningpandemyafeedbackcurrentbadingjunjunheftybakasyongrinsentertainmentpinaghatidanbooksnakatapattinungoaniyatoomag-asawangpaghabasinipangkayatumahanmaghatinggabivednapakatumalimlivechoicedespuespinunitpagpapakilalahappenedpasswordnanunuksoblesselectpagsalakaykababaihanasuldiwatapagbebentabutihinginfinitypagkalungkothalamanmulingvaccinesikinabitcomputerekalalarokapitbahaytuvomababawinvesting:harililigawankaniyapumasokbinatakdenboyetjosekapangyarihangtalentedmag-uusapelementaryniyanalagutanpapuntakuripotestablishnakapasacomputere,magturotssspagtiisanagosmainitkalikasanmatandang-matandamakaindesisyonantsonggotelebisyongeologi,atinpulonghalamangnabahalalumipatbaranggayunosparangnagpalalimredyamanoktubrerepublicanpinagsulatgayunpamanlumabasnakumbinsikasinggodnagliliyabfutureagaw-buhaymalezapakikipagbabagkinikilalanggayunmanenglishpamilyapagpapakalatmalumbaylargerlibrepinakamatapatparticipatingnathanbagamateksempelfindiyakkalakiiskedyulrelonalalamanresultmabutibilhantumawagsisterconsidereddumaannerissatinanggapmallyaripakilutomakapangyarihangputiestudyantenapatayobangladeshipinabalotmakikipagsayawsabadonghumahangahanapinvictorialatemayabangdyipnimissionmagalang1982nagsagawaeducationbumabahamedya-agwatsinanakapuntabinitiwanmagworkrelievedsumindihverlungsodemailpagpapasanagam-agampag-uwibadspeedclassroomwhyrosemagka-aponunona-fundnariyanlaranganhimignag-oorasyontulisansusulitallesakimmagpagupitnakasahodkinabukasan