Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "massachusetts"

1. Nasa Massachusetts ang Stoneham.

Random Sentences

1. Sa halip na maghanap, sinalat na lang niya ang ibabaw ng mesa para sa relo.

2. Ang dedikasyon ni Carlos Yulo sa kanyang isport ay nagdala sa kanya ng tagumpay sa pandaigdigang entablado.

3. Inilagay nya sa poon ang biniling sampaguita.

4. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

5. Libre si Clara sa Sabado ng hapon.

6. The computer works perfectly.

7. He likes to read books before bed.

8. May mga taong may kondisyon tulad ng insomnia na nagdudulot sa kanila ng problema sa pagtulog.

9. Las plantas perennes viven durante varios años, renovando sus hojas y flores de forma periódica.

10. A couple of candles lit up the room and created a cozy atmosphere.

11. Nangangako akong pakakasalan kita.

12. Umalis siya papuntang Cebu kahapon ng hapon.

13. Magbibiyahe ako sa Mindanao sa isang taon.

14. The sports center offers a variety of activities, from swimming to tennis.

15. Los powerbanks también pueden tener características adicionales, como indicadores LED que muestran el nivel de carga.

16. Players move the ball by dribbling, passing, or shooting it towards the basket.

17. Las redes sociales también pueden ser una herramienta para hacer campañas de concientización y recaudar fondos.

18. Ang talakayan ay ukol kay Dr. Jose Rizal at sa kanyang mga kontribusyon sa bansa.

19. Det er også vigtigt at sætte et budget og begrænse sin risiko for at undgå at miste mere end man har råd til.

20. Tumayo siya tapos nagmadaling pumunta sa cr

21. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

22. Pwede ko ba makuha ang cellphone number mo?

23. At leve med en god samvittighed kan hjælpe os med at opbygge stærke og tillidsfulde relationer med andre mennesker.

24. In the early days, telephones were connected to a central switchboard, which connected calls manually

25. The store has a variety of sizes available, from small to extra-large.

26. Viruses are small, infectious agents that can infect cells and cause diseases.

27. Nagmamadali na ako ngunit dumaan pa sa gasolinahan ang driver ng dyip.

28. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

29. At blive kvinde handler også om at lære at tage vare på sig selv både fysisk og mentalt.

30. Hindi sila makaangal sa di makatarungang pagpapautang.

31. El accidente produjo un gran tráfico en la carretera principal.

32. He cooks dinner for his family.

33. Consumir una variedad de frutas y verduras es una forma fácil de mantener una dieta saludable.

34. Iyong kulay itim na bag ang bag ko.

35. Sometimes it is necessary to let go of unrealistic expectations or goals in order to alleviate frustration.

36. Mayroon kaming bahay sa Tagaytay.

37. Nagtagumpay siya sa kanyang agaw-buhay na laban sa kanyang sakit.

38. Fleksibilitetstræning, såsom yoga og strækning, kan hjælpe med at forbedre bevægeligheden og reducere risikoen for skader.

39. Attractive packaging and expert publicity helped spread the addiction to smoking cigarettes even among the poorer sections of the people

40. The artist's intricate painting was admired by many.

41. Ang pagbibigay ng ampao ay isang tradisyonal na paraan ng pagpapakita ng paggalang sa matatanda sa Chinese New Year.

42. I don't think we've met before. May I know your name?

43. Yey! Thank you Jacky! The best ka talaga!

44. Lazada is an e-commerce platform that operates in Southeast Asia.

45. Nagkaroon ng malubhang aksidente sa konstruksyon kung saan namatay ang ilang manggagawa.

46. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

47. Kevin Garnett was a versatile power forward who brought intensity and defensive prowess to the court.

48. Nag-iisa siya at tulala sa gitna ng kalsada nang makita ko siya kaninang umaga.

49. Hindi ako makahinga nang maayos kaya nanghina ako at nag-halinghing nang malalim.

50. The legislative branch, represented by the US

Recent Searches

massachusettspagsidlanbinawianescuelasfreedomsnagniningningnakainlalawiganbingbingboholkumukulodalagangpataysetyembrekaarawanganapgiverfitenglandeksportennandiyanrepublicantibokdadalokumapityamancompletamentebayangestilosbandasapilitangmatarayhundredkasibulakkasaysayanassociationsinapakramdamsubalitmarioomgcovidyep11pmipatuloylegislationimportantesearnbarnespalayangenerationercommunicationkararatingpasadyaspamillionskagabireservedcoatsambitgenerabacircleinternalsinunud-ssunodmalamangnabalitaannangyariculturalnagawangmanahimikpropesorinstrumentalbahaylayuansang-ayonreynasitaworganizehigitvehiclescigarettemaibigayherramientachecksstaypaglakicardkahusayanofrecennilalanghabangcommunicatemagpa-ospitalkasalukuyangexpeditedeffortsgodtlalargamapalampasmagpasalamatsalitangnakakunot-noongkumustaallowingunangpagkalitoestatekonsentrasyonkuwentopananglawmaawaingpakibigyanmagtatakawinsnahulaanexpertiseheartbeatcubiclenagsimulaaffiliateelectionsbillusafuncionarmahalindatiapolloyonpagsasalitaagwadorkarwahengpresence,estasyonlabing-siyambulaklakmakausapminatamisrewardingplantaskristonagbentanetflixmariaitinulosanywherebumigaytinapayeveningorugatwitchlargeanumanghinagud-hagoduulaminika-50ninanaislumibotmanalopwedengmatangkadkatagangsacrificepangakosoonlapitanaddresswalletcontrolaseenlumiwanagtigillagnatmaisusuotjanebarrerastandanglilikokuwebamarietaksimatitigasmuntikandisyembrematulisroomtonightserfertilizervampiresrequireimpitlumalakiinilalabasmagka-aponagbanggaanalagahagdanheimakakatakas