Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

77 sentences found for "used"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

3. AI algorithms can be used in a wide range of applications, from self-driving cars to virtual assistants.

4. AI algorithms can be used to analyze large amounts of data and detect patterns that may be difficult for humans to identify.

5. AI algorithms can be used to automate tasks and improve efficiency in industries such as manufacturing and logistics.

6. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

7. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

8. An oscilloscope is a measuring instrument used to visualize and analyze electrical waveforms.

9. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

10. Antiviral medications can be used to treat some viral infections, but there is no cure for many viral diseases.

11. Baby fever is a term often used to describe the intense longing or desire to have a baby.

12. Cryptocurrency can be used for both legal and illegal transactions.

13. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

14. Cryptocurrency offers an alternative to traditional banking systems and can be used for remittances and cross-border transactions.

15. Cryptocurrency wallets are used to store and manage digital assets.

16. Dogs have a keen sense of smell and are often used in law enforcement and search and rescue operations.

17. Emphasis can also be used to create a sense of urgency or importance.

18. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

19. Emphasis can be used to create a memorable and impactful message.

20. Emphasis can be used to create a sense of drama or suspense.

21. Emphasis can be used to create rhythm and cadence in language.

22. Emphasis can be used to express emotion and convey meaning.

23. Emphasis can be used to highlight a person's strengths and abilities.

24. Emphasis can be used to persuade and influence others.

25. Emphasis can be used to provide clarity and direction in writing.

26. Emphasis is often used in advertising and marketing to draw attention to products or services.

27. Emphasis is often used to highlight important information or ideas.

28. Hashtags (#) are used on Twitter to categorize and discover tweets on specific topics.

29. He also believed that martial arts should be used for self-defense and not for violence or aggression

30. He used credit from the bank to start his own business.

31. He used his credit to buy a new car but now struggles to make the monthly payments.

32. He used his good credit score as leverage to negotiate a lower interest rate on his mortgage.

33. He used TikTok to raise awareness about a social cause and mobilize support.

34. However, the quality of the data used to train AI algorithms is crucial, as biased or incomplete data can lead to inaccurate predictions and decisions.

35. I used a traffic app to find the fastest route and avoid congestion.

36. I used my credit card to purchase the new laptop.

37. LeBron has used his platform to advocate for social justice issues, addressing inequality and supporting initiatives to effect positive change.

38. Mathematical concepts, such as fractions and decimals, are used in daily life, such as cooking and shopping.

39. Mathematical concepts, such as geometry and calculus, are used in many everyday activities.

40. Mathematical formulas and equations are used to express relationships and patterns.

41. Mathematical proofs are used to verify the validity of mathematical statements.

42. Mathematics can be used to analyze data and make informed decisions.

43. Mathematics can be used to model real-world situations and make predictions.

44. Mathematics can be used to optimize processes and improve efficiency.

45. Mathematics is a language used to describe and solve complex problems.

46. Microscopes are also used in materials science and engineering to study the microstructure of materials.

47. Microscopes are commonly used in scientific research, medicine, and education.

48. Microscopes are used to study cells, microorganisms, tissues, and other small structures.

49. Microscopes can also be used to analyze the chemical composition of materials, such as minerals and metals.

50. Microscopes can be used to study living organisms in real-time, allowing researchers to observe biological processes as they occur.

51. Microscopes can be used to study the structure and function of the brain and other organs.

52. Microscopes have been used to discover and identify new species of microorganisms and other small organisms.

53. Money can be used for both needs and wants, and balancing these priorities is important for financial success.

54. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

55. Money has value because people trust that it can be used to purchase goods and services.

56. Money is a medium of exchange used to buy and sell goods and services.

57. My grandfather used to tell me to "break a leg" before every soccer game I played.

58. Nationalism has been used to justify imperialism and expansionism.

59. Nationalism has been used to mobilize people in times of war and crisis.

60. Oscilloscopes are commonly used in electronics, telecommunications, engineering, and scientific research.

61. Pinking shears are scissors with zigzag-shaped blades used for cutting fabric to prevent fraying.

62. Scissors are commonly used for cutting paper, fabric, and other materials.

63. Scissors are commonly used in various industries, including arts and crafts, sewing, hairdressing, and cooking.

64. Some viruses, such as bacteriophages, can be used to treat bacterial infections.

65. Sweeteners are often used in processed foods to enhance flavor and extend shelf life.

66. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

67. Sweetness can be used to mask other flavors and create a more palatable taste.

68. The company used the acquired assets to upgrade its technology.

69. The concept of God has also been used to justify social and political structures, with some societies claiming divine authority for their rulers or laws.

70. The forensic evidence was used to convict the culprit in the arson case.

71. The scientific method is used to ensure that experiments are conducted in a rigorous and unbiased manner.

72. The scientific method is used to test and refine theories through experimentation.

73. The stock market can be used as a tool for generating wealth and creating long-term financial security.

74. TV can be used for educating the masses, for bringing to us the latest pieces of information audio-visually and can provide us with all kinds of entertainment even in colour.

75. Twitter is also used by businesses and brands for marketing, customer engagement, and brand promotion.

76. Viruses can be used as vectors to deliver genetic material into cells, which can be used to treat genetic disorders.

77. Viruses have been used in genetic engineering and biotechnology to develop new therapies and treatments.

Random Sentences

1. High blood pressure can often be managed with a combination of medication and lifestyle changes.

2. La tos crónica dura más de ocho semanas y puede ser causada por una variedad de factores.

3. Las redes sociales tienen un impacto en la forma en que las personas se comunican y relacionan.

4. Puwede bang pahiram ng isang kutsara? Nakalimutan ko ang aking sa bahay.

5. Kucing di Indonesia juga dikenal dengan sebutan "meong" atau "ngomong" karena suaranya yang unik.

6. Saya tidak setuju. - I don't agree.

7. Magdamag kong naiwang bukas ang ilaw.

8. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

9. Napilitan siyang bumangon at naghanda ng pagkain.

10. They offer rewards and cashback programs for using their credit card.

11. Nagsusulat ako ng mga kwento at mga katha upang palawakin ang aking imahinasyon.

12. Virksomheder i Danmark, der eksporterer varer, er afgørende for den danske økonomi.

13. Ang mahal pala ng ticket papuntang Amerika!

14. She found her passion for makeup through TikTok, watching tutorials and learning new techniques.

15. Las personas pobres a menudo viven en condiciones precarias y carecen de seguridad económica.

16. Sa kabila ng kanyang tagumpay, nananatiling humble at grounded si Carlos Yulo.

17. The church organized a charitable drive to distribute food to the homeless.

18. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

19. Ang mga medical technologist nagsisilbi upang magbigay ng tumpak na resulta sa mga laboratory tests.

20. Madalas lang akong nasa library.

21. Buenas tardes amigo

22. Sinabi ng guro na mayroong eksaminasyon sa susunod na linggo.

23. Wag mo naman hayaang mawala siya sakin.

24. "Every dog has its day."

25. Muchas personas disfrutan tocando instrumentos musicales como hobby.

26. There are a lot of reasons why I love living in this city.

27. Work can also provide opportunities for personal and professional growth.

28. Ligaya ang pangalan ng nanay ko.

29. Dalam Islam, kelahiran bayi yang baru lahir diiringi dengan adzan dan takbir sebagai bentuk syukur kepada Allah SWT.

30. Ang pagpapabaya sa mga ebidensya at katotohanan ay nagdudulot ng pagkaligaw sa landas ng katarungan.

31. Muntikan na akong mauntog sa pinto.

32. Mahusay siya sa komunikasyon at liderato, samakatuwid, siya ang nahirang na bagong presidente ng organisasyon.

33. Si Imelda ay maraming sapatos.

34. Kung sino ang maagap, siya ang magandang kinabukasan.

35. Ngunit may isang bata ang may bulate kaya lagi siyang walang gana.

36. D'you know what time it might be?

37. The culprit behind the vandalism was eventually caught and held accountable for their actions.

38. A los 13 años, Miguel Ángel comenzó su aprendizaje en el taller de Domenico Ghirlandaio.

39. Tesla is also involved in the development and production of renewable energy solutions, such as solar panels and energy storage systems.

40. Doa adalah salah satu bentuk hubungan spiritual yang penting dalam hidup manusia di Indonesia.

41. Lumalangoy ako kapag nasa tabingdagat kami.

42. Anong kailangan mo? pabalang kong tanong.

43. Nagtaas na nang pamasahe ang bus.

44. Kailangan ko umakyat sa room ko.

45. Wala ka naman sa kabilang kwarto eh.

46. They may draft and introduce bills or resolutions to address specific concerns or promote change.

47. Mathematics has many practical applications, such as in finance, engineering, and computer science.

48. She burned the dinner and then the smoke alarm went off. That just added insult to injury.

49. Fødslen er en tid til at fejre og værdsætte kvinders styrke og mod.

50. Bago ang kasal, nagkaruon muna sila ng seremonya kung saan nagmamano siya bilang bahagi ng pamamamanhikan.

Similar Words

misused

Recent Searches

usedlarryitinuturingpeterbabaeplatformschadlongchambersheipollutionimpacthusograceworrysangkalanprogramming,visualmulingstructurepilingactivityenvironmentmalakingstreamingpointmesaregularmentecomofamilynagpagawamakalaglag-pantysiyudadkapalorganizematigashunyovehiclespagkakapagsalitapssspatutunguhanpakipuntahanflaviopagkabuhaynagawangpagkatakotsalbahenghukayhinahanapmahinahongpopularizesumabogpookmoodspillpagkalitounahumiwalaypreviouslyadvancedeveryeditorsaritagagawinmagbabagsiknagmamadaliramdamkinauupuantakesattentionbotonoongsameiwinasiwascomputerpag-irrigateformsknowledgeintelligenceeffectpagpilipupuntahansasamahandahan-dahanpamilihandahondreamshumahangoskindergartensunpalagingpamamasyalpagbabantanatinagaksidentebasketbollalimbalitacapacidadisipanautomationtableiyomalihiscondosoccerchessfianotebooktriplcdkelanusoinfusionestog,biologipalancaspeechnagdaosdeterminasyondiversidaduniversitiestonyestámagtigilkulturnuevoscareerpataykinganghelaabotvalleytumatawagknownengkantadangpumapaligidmadalasthesededicationnakatirangmerchandisetumatakbobighanipagputinalugmoksportskapangyarihannagdadasalmagnakawmakilalamagbibigayskypenagluto00amnaghuhumindigkonsyertodaratingadvancesinterestsnagaganappinagwagihangislatalagapadabogresortcoatnecesarioappmakikitulogmahirapmagdoorbelloktubrepootcaraballoperokatutubogayunmanbaokumarimotpesosgarbansosumiwasnagsasagotayawentreempresasmangahaspag-uwileveragedevelopitukodpagsuboklumilingongawainggubatgitanasbumangonsumingitedit