Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

77 sentences found for "used"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

3. AI algorithms can be used in a wide range of applications, from self-driving cars to virtual assistants.

4. AI algorithms can be used to analyze large amounts of data and detect patterns that may be difficult for humans to identify.

5. AI algorithms can be used to automate tasks and improve efficiency in industries such as manufacturing and logistics.

6. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

7. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

8. An oscilloscope is a measuring instrument used to visualize and analyze electrical waveforms.

9. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

10. Antiviral medications can be used to treat some viral infections, but there is no cure for many viral diseases.

11. Baby fever is a term often used to describe the intense longing or desire to have a baby.

12. Cryptocurrency can be used for both legal and illegal transactions.

13. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

14. Cryptocurrency offers an alternative to traditional banking systems and can be used for remittances and cross-border transactions.

15. Cryptocurrency wallets are used to store and manage digital assets.

16. Dogs have a keen sense of smell and are often used in law enforcement and search and rescue operations.

17. Emphasis can also be used to create a sense of urgency or importance.

18. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

19. Emphasis can be used to create a memorable and impactful message.

20. Emphasis can be used to create a sense of drama or suspense.

21. Emphasis can be used to create rhythm and cadence in language.

22. Emphasis can be used to express emotion and convey meaning.

23. Emphasis can be used to highlight a person's strengths and abilities.

24. Emphasis can be used to persuade and influence others.

25. Emphasis can be used to provide clarity and direction in writing.

26. Emphasis is often used in advertising and marketing to draw attention to products or services.

27. Emphasis is often used to highlight important information or ideas.

28. Hashtags (#) are used on Twitter to categorize and discover tweets on specific topics.

29. He also believed that martial arts should be used for self-defense and not for violence or aggression

30. He used credit from the bank to start his own business.

31. He used his credit to buy a new car but now struggles to make the monthly payments.

32. He used his good credit score as leverage to negotiate a lower interest rate on his mortgage.

33. He used TikTok to raise awareness about a social cause and mobilize support.

34. However, the quality of the data used to train AI algorithms is crucial, as biased or incomplete data can lead to inaccurate predictions and decisions.

35. I used a traffic app to find the fastest route and avoid congestion.

36. I used my credit card to purchase the new laptop.

37. LeBron has used his platform to advocate for social justice issues, addressing inequality and supporting initiatives to effect positive change.

38. Mathematical concepts, such as fractions and decimals, are used in daily life, such as cooking and shopping.

39. Mathematical concepts, such as geometry and calculus, are used in many everyday activities.

40. Mathematical formulas and equations are used to express relationships and patterns.

41. Mathematical proofs are used to verify the validity of mathematical statements.

42. Mathematics can be used to analyze data and make informed decisions.

43. Mathematics can be used to model real-world situations and make predictions.

44. Mathematics can be used to optimize processes and improve efficiency.

45. Mathematics is a language used to describe and solve complex problems.

46. Microscopes are also used in materials science and engineering to study the microstructure of materials.

47. Microscopes are commonly used in scientific research, medicine, and education.

48. Microscopes are used to study cells, microorganisms, tissues, and other small structures.

49. Microscopes can also be used to analyze the chemical composition of materials, such as minerals and metals.

50. Microscopes can be used to study living organisms in real-time, allowing researchers to observe biological processes as they occur.

51. Microscopes can be used to study the structure and function of the brain and other organs.

52. Microscopes have been used to discover and identify new species of microorganisms and other small organisms.

53. Money can be used for both needs and wants, and balancing these priorities is important for financial success.

54. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

55. Money has value because people trust that it can be used to purchase goods and services.

56. Money is a medium of exchange used to buy and sell goods and services.

57. My grandfather used to tell me to "break a leg" before every soccer game I played.

58. Nationalism has been used to justify imperialism and expansionism.

59. Nationalism has been used to mobilize people in times of war and crisis.

60. Oscilloscopes are commonly used in electronics, telecommunications, engineering, and scientific research.

61. Pinking shears are scissors with zigzag-shaped blades used for cutting fabric to prevent fraying.

62. Scissors are commonly used for cutting paper, fabric, and other materials.

63. Scissors are commonly used in various industries, including arts and crafts, sewing, hairdressing, and cooking.

64. Some viruses, such as bacteriophages, can be used to treat bacterial infections.

65. Sweeteners are often used in processed foods to enhance flavor and extend shelf life.

66. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

67. Sweetness can be used to mask other flavors and create a more palatable taste.

68. The company used the acquired assets to upgrade its technology.

69. The concept of God has also been used to justify social and political structures, with some societies claiming divine authority for their rulers or laws.

70. The forensic evidence was used to convict the culprit in the arson case.

71. The scientific method is used to ensure that experiments are conducted in a rigorous and unbiased manner.

72. The scientific method is used to test and refine theories through experimentation.

73. The stock market can be used as a tool for generating wealth and creating long-term financial security.

74. TV can be used for educating the masses, for bringing to us the latest pieces of information audio-visually and can provide us with all kinds of entertainment even in colour.

75. Twitter is also used by businesses and brands for marketing, customer engagement, and brand promotion.

76. Viruses can be used as vectors to deliver genetic material into cells, which can be used to treat genetic disorders.

77. Viruses have been used in genetic engineering and biotechnology to develop new therapies and treatments.

Random Sentences

1. Football is a popular team sport that is played all over the world.

2. Sa anong tela yari ang pantalon?

3. Ano ang pinag-aaralan ni Cora?

4. Malapit lamang pala ang pinaghatidan nito ng tubig.

5. Kapag may isinuksok, may madudukot.

6. Kebahagiaan tidak selalu tergantung pada materi atau kekayaan, tetapi pada keadaan batin dan kepuasan diri.

7. Tomar decisiones basadas en nuestra conciencia puede ser difícil, pero a menudo es la mejor opción.

8. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

9. Ang pagpapatingin sa dentista ay hindi lamang para sa kalusugan ng ngipin, kundi para na rin sa kabuuan ng kalusugan ng katawan.

10. Tinanggal ko na yung maskara ko at kinausap sya.

11. Representatives often hold regular meetings or town halls to connect with their constituents and gather feedback.

12. Nag-ayos ng gamit ang mga mag-aaral nang limahan.

13. Hanggang kailan mo ako girlfriend? diretsahang sabi ko.

14. Maraming mga mahuhusay na maghahabi ang tumaggap sa hamon ng batang si Amba.

15. Napatingin ako sa kanya bigla, Kenji?

16. Nagplano akong maglakad-lakad sa park, datapwat bigla akong tinawagan ng aking kaibigan para magkape.

17. Las escuelas ofrecen diferentes planes de estudios, dependiendo del nivel y la especialización.

18. Naging kaulayaw ko siya noong ako'y nag-aaral pa lamang.

19. He's known to exaggerate, so take what he says with a grain of salt.

20. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

21. The acquired assets will be a valuable addition to the company's portfolio.

22. Tinanggap niya ang lahat ng ito at marami pang iba sa kaniyang kaarawan.

23. Estos dispositivos ejecutan sistemas operativos como Android o iOS y pueden descargar y ejecutar aplicaciones de diferentes categorías, como juegos, redes sociales, herramientas de productividad, entre otras

24. Andre helte er stille helte, der arbejder i skyggerne.

25. Ngunit nagliliyab pa rin ang poot sa kanyang mga mata.

26. They volunteer at the community center.

27. Halos lahat ng pwede nyang bilihin ay nasa Lazada na.

28. Nagpunta ako sa may lobby para magisip.

29. Nakahain na ako nang dumating siya sa hapag.

30. The presentation was absolutely flawless; you did a great job.

31. Labis kang nasugatan, mabuti pa siguro ay sumama ka sa akin upang magamot ng aking asawa ang iyong mga sugat.

32. Nagitla siya nang bago pa makalapit ay nagpalit anyo ito.

33. Les personnes âgées peuvent avoir des difficultés à mémoriser et à apprendre de nouvelles informations.

34. Selvstændige medarbejdere arbejder ofte på egen hånd.

35. Bakit di mo 'to sinabi sa akin?

36. The invention of the telephone led to the creation of the first radio dramas and comedies

37. La música es una forma de arte universal que se ha practicado en todas las culturas desde tiempos ancestrales

38. Nakipagtagisan sya ng lakas sa mga kalaban.

39. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

40. Bis später! - See you later!

41. Sa lahat ng bagay, mahalaga ang tamang panahon.

42. Sinabi niya walang kapatawaran ang pag-iwan at pagpalit nito sa babae ng kanilang pamilya

43. Aku merindukanmu, sayang. (I miss you, dear.)

44. El internet ha hecho posible la creación de comunidades en línea alrededor de intereses comunes.

45. Inflation kann auch durch eine Verringerung des Angebots an Waren und Dienstleistungen verursacht werden.

46. nadama niya ang bagong tuklas na lakas niyon.

47. Ang pagtambay sa ilalim ng puno ay nagdudulot ng maginhawang lilim mula sa init ng tanghali.

48. Isa-isa niyang tiningnan ang mga nakapaligid sa kanya.

49. Ang pagsisimula ng malakas na away sa loob ng tahanan ay binulabog ang katahimikan ng pamilya.

50. Pasensya na, hindi kita maalala.

Similar Words

misused

Recent Searches

usedtools,paycryptocurrencyfakeipagbilinuonleytesynccontinueinteractthirdrequirebroadrelievedchavitroomorugabroughtsnoblutodalawaclientsbillsupremegracekararatingbarbilereveningchangeavailableaninakakapamasyalpagsasalitahila-agawannakaka-inpagngitinakabulagtangnakakatulongbakenakapasokpagkagustomonsignorlabing-siyamtog,pictureskapatawarannag-alalakapangyarihanhumingarenacentistanapahintopasaheropananglawinterests,mag-ingatkongresocaraballonapadaanhanapinnabiglamag-isanapadpadrestmatutonghinalungkatmasaktankeepingbumalikkunwabisikletasabogkambingbutiperwisyohinintayjocelynkapainwaterkontingtuvosapotproductshetobiliyarifrescolumilingonhigh-definitioniconsnagbabababiocombustiblesalexanderfonoscelularesresumenindiatanodtsakalumulusobpaki-drawingmaismaulitgenemalisanmapagkalingakalangumawagawaingmagka-babylumipassabadongadvancementwordsnagtatanonghverkasaysayankalalarosenatepalancabasahinpagbabagong-anyobangbinibiyayaankukuhapwedebobopinagsanglaanadverselymillionswaysfigureslavemiyerkulespagsisisialikabukinkapiranggotmaglutotaga-ochandodissekapepalamutipabiliperfectmakatarunganghabitestadosganaimprovengisifittuwangtopic,palaginghusaynitonasirapinagawapananghaliannananalongtarangkahannag-iimbitanaiilagannakadapapagmamanehoantonio1954surveysnagpasamaisasamasiopaosiyudadbilibidsamantalangorkidyastapepinansincanteenlungsodpaninigascualquiermakaiponlumutangkaninogayundinpalipat-lipatpagbisitadaladalasupilinaumentarbinasayatainterestsnagpuntaeclipxeitaasmakakalimutinnapakomakakabalik