Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

77 sentences found for "used"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

3. AI algorithms can be used in a wide range of applications, from self-driving cars to virtual assistants.

4. AI algorithms can be used to analyze large amounts of data and detect patterns that may be difficult for humans to identify.

5. AI algorithms can be used to automate tasks and improve efficiency in industries such as manufacturing and logistics.

6. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

7. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

8. An oscilloscope is a measuring instrument used to visualize and analyze electrical waveforms.

9. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

10. Antiviral medications can be used to treat some viral infections, but there is no cure for many viral diseases.

11. Baby fever is a term often used to describe the intense longing or desire to have a baby.

12. Cryptocurrency can be used for both legal and illegal transactions.

13. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

14. Cryptocurrency offers an alternative to traditional banking systems and can be used for remittances and cross-border transactions.

15. Cryptocurrency wallets are used to store and manage digital assets.

16. Dogs have a keen sense of smell and are often used in law enforcement and search and rescue operations.

17. Emphasis can also be used to create a sense of urgency or importance.

18. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

19. Emphasis can be used to create a memorable and impactful message.

20. Emphasis can be used to create a sense of drama or suspense.

21. Emphasis can be used to create rhythm and cadence in language.

22. Emphasis can be used to express emotion and convey meaning.

23. Emphasis can be used to highlight a person's strengths and abilities.

24. Emphasis can be used to persuade and influence others.

25. Emphasis can be used to provide clarity and direction in writing.

26. Emphasis is often used in advertising and marketing to draw attention to products or services.

27. Emphasis is often used to highlight important information or ideas.

28. Hashtags (#) are used on Twitter to categorize and discover tweets on specific topics.

29. He also believed that martial arts should be used for self-defense and not for violence or aggression

30. He used credit from the bank to start his own business.

31. He used his credit to buy a new car but now struggles to make the monthly payments.

32. He used his good credit score as leverage to negotiate a lower interest rate on his mortgage.

33. He used TikTok to raise awareness about a social cause and mobilize support.

34. However, the quality of the data used to train AI algorithms is crucial, as biased or incomplete data can lead to inaccurate predictions and decisions.

35. I used a traffic app to find the fastest route and avoid congestion.

36. I used my credit card to purchase the new laptop.

37. LeBron has used his platform to advocate for social justice issues, addressing inequality and supporting initiatives to effect positive change.

38. Mathematical concepts, such as fractions and decimals, are used in daily life, such as cooking and shopping.

39. Mathematical concepts, such as geometry and calculus, are used in many everyday activities.

40. Mathematical formulas and equations are used to express relationships and patterns.

41. Mathematical proofs are used to verify the validity of mathematical statements.

42. Mathematics can be used to analyze data and make informed decisions.

43. Mathematics can be used to model real-world situations and make predictions.

44. Mathematics can be used to optimize processes and improve efficiency.

45. Mathematics is a language used to describe and solve complex problems.

46. Microscopes are also used in materials science and engineering to study the microstructure of materials.

47. Microscopes are commonly used in scientific research, medicine, and education.

48. Microscopes are used to study cells, microorganisms, tissues, and other small structures.

49. Microscopes can also be used to analyze the chemical composition of materials, such as minerals and metals.

50. Microscopes can be used to study living organisms in real-time, allowing researchers to observe biological processes as they occur.

51. Microscopes can be used to study the structure and function of the brain and other organs.

52. Microscopes have been used to discover and identify new species of microorganisms and other small organisms.

53. Money can be used for both needs and wants, and balancing these priorities is important for financial success.

54. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

55. Money has value because people trust that it can be used to purchase goods and services.

56. Money is a medium of exchange used to buy and sell goods and services.

57. My grandfather used to tell me to "break a leg" before every soccer game I played.

58. Nationalism has been used to justify imperialism and expansionism.

59. Nationalism has been used to mobilize people in times of war and crisis.

60. Oscilloscopes are commonly used in electronics, telecommunications, engineering, and scientific research.

61. Pinking shears are scissors with zigzag-shaped blades used for cutting fabric to prevent fraying.

62. Scissors are commonly used for cutting paper, fabric, and other materials.

63. Scissors are commonly used in various industries, including arts and crafts, sewing, hairdressing, and cooking.

64. Some viruses, such as bacteriophages, can be used to treat bacterial infections.

65. Sweeteners are often used in processed foods to enhance flavor and extend shelf life.

66. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

67. Sweetness can be used to mask other flavors and create a more palatable taste.

68. The company used the acquired assets to upgrade its technology.

69. The concept of God has also been used to justify social and political structures, with some societies claiming divine authority for their rulers or laws.

70. The forensic evidence was used to convict the culprit in the arson case.

71. The scientific method is used to ensure that experiments are conducted in a rigorous and unbiased manner.

72. The scientific method is used to test and refine theories through experimentation.

73. The stock market can be used as a tool for generating wealth and creating long-term financial security.

74. TV can be used for educating the masses, for bringing to us the latest pieces of information audio-visually and can provide us with all kinds of entertainment even in colour.

75. Twitter is also used by businesses and brands for marketing, customer engagement, and brand promotion.

76. Viruses can be used as vectors to deliver genetic material into cells, which can be used to treat genetic disorders.

77. Viruses have been used in genetic engineering and biotechnology to develop new therapies and treatments.

Random Sentences

1. Nang siya'y mapaibabaw, sinunud-ssunod niya: dagok, dagok, dagok.

2. Minsan, nagulat ang pamilya sa pagdating ni Roque dahil may kasama itong lalaking may sugat.

3. We were trying to keep the details of our business plan under wraps, but one of our investors let the cat out of the bag to our competitors.

4. Ang pakikinig sa mahinahong agos ng ilog ay nagbibigay sa akin ng isang matiwasay na pakiramdam ng kalma at katahimikan.

5. Kumaen ka na ba? tanong niya sa akin.

6. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

7. Hindi dapat gamitin ang credit card nang walang sapat na pag-iingat dahil ito ay nagdudulot ng dagdag na gastos at utang.

8. The company's acquisition of new assets will help it expand its global presence.

9. Ang mensahe ay ibinigay ng isang misteryosong lalake.

10. Ang diploma ay isang sertipiko o gawa na inisyu ng isang institusyong pang-edukasyon

11. He has visited his grandparents twice this year.

12. Sana ay makapasa ako sa board exam.

13. The students are studying for their exams.

14. Samantala sa pamumuhay sa probinsya, natutunan niyang mas ma-appreciate ang kagandahan ng kalikasan.

15. Ang poot ang nagbibigay sa akin ng lakas at determinasyon upang harapin ang mga hamon ng buhay.

16. El dibujo de la anatomía humana fue uno de los mayores intereses de Leonardo da Vinci.

17. En invierno, las temperaturas suelen ser bajas y el clima es más fresco.

18. Tuwing biyernes, ginugol niya ang buong araw sa paglilinis at paglalaba ng bahay.

19. Ikaw ang bumitaw! hila-agawan ang ginagawa namin.

20. They are shopping at the mall.

21. It takes one to know one

22. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

23. Bawat umaga, ako'y bumabangong maaga para maglakad sa dalampasigan ng karagatan.

24. Maraming tao ang nagpaplastikan sa harap ng ibang tao para lang mapasama.

25. Ang aming angkan ay mayroong natatanging uri ng pagluluto.

26. En invierno, se pueden ver hermosos paisajes cubiertos de nieve y montañas nevadas.

27. Tinamaan ng lumilipad na bola ang bintana at ito’y nabasag.

28. Hendes karisma er så fascinerende, at alle omkring hende bliver tiltrukket af hende. (Her charisma is so fascinating that everyone around her is drawn to her.)

29.

30. Ipinahamak sya ng kanyang kaibigan.

31. Hindi maiiwasang magkaroon ng mga biktima sa digmaan, kasama na ang mga sibilyan.

32. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

33. Påsken er en tid, hvor mange mennesker giver til velgørende formål og tænker på andre, der har brug for hjælp.

34. Sa mga lugar na malapit sa ilog, ang mga punong-kahoy ay nakakatulong sa pagpapabuti ng kalidad ng tubig.

35. Las serpientes tienen una lengua bifurcada que utilizan para captar olores y explorar su entorno.

36. Hinugot niya ang kanyang cellphone upang mag-reply sa aking mensahe.

37. Foreclosed properties may have a lot of competition from other buyers, especially in desirable locations.

38. Nagbigay ang albularyo ng anting-anting upang protektahan ang bata sa masasamang espiritu.

39. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

40. Påskeæg er en traditionel gave i påsken og er ofte fyldt med slik eller små gaver.

41. Ano ang nahulog mula sa puno?

42. El trigo es uno de los cultivos más importantes a nivel mundial para la producción de harina.

43. Umulan man o umaraw, darating ako.

44. Naghingi ako ng pahintulot na hiramin ang kotse ng aking magulang para sa isang family outing.

45. Kung hindi ngayon, kailan pa ang tamang panahon?

46. Hinahangaan siya ng marami dahil sa kanyang pagiging mapagkumbaba kahit galing siya sa mababa na estado ng buhay.

47. Environmental protection requires a long-term vision and commitment to future generations.

48. Sa droga, walang nagwawagi kundi ang tao mismo.

49. Beauty! yumakap pa mula sa likod ko si Maico.

50. Siya ay hinugot mula sa kanyang pagkakakulong matapos ma-prove na walang kasalanan.

Similar Words

misused

Recent Searches

usedtunaystatesongssafenapakabagalexamplenakakamitnaibabahihigaginawacommercialvetostorysocietyililibreifugaoalaalasumalispeechesblusaandamingusetrabahomatatagpalakamabaititobakitthankssobratrapikorkidyasmagsungitbusilakbuwanpaghihiraplalongsittingdistanciamatiyaknagkakakaingayanobodyflamenconakasimangotnalamanboracaypicturelalabhantransportmaisusuotpagnanasafremstilleamazonpagongpasigawsalabumangonlarawanitinanimmurang-muratanawinakonamannanginginigbackpackspindletuluyangagadmag-aaralkawayandamdaminmariahaponnagliliyabmatulogmalayongsagingwordnalakifittelebisyongatherengkantadangpamilyapagtitindahindesinasadyatangobutikiimportantpaghahanappagkakampokamanapakaalatbateryataganag-uwimasayangaminkokaksalapisisipainsasabihinarbejderalignssorrysumusunodsakimaposilyakumakalansingkapit-bahaydevelopedstrategyt-ibangsupilintagumpaytatlostillbutpeople'smeronunconstitutionaltaga-hiroshimamahiligpasswordtalagangtipsgalawnakapaligidnahawacomputere,mauupokaraniwangbroughttactopasukankilopag-aaralangmaputlamahahawagumagalaw-galawhotelkampeoncandidatesnaghihiraphigitdailynapalakasmangungudngodmonitorminutegabrielbinyagangmagpagupitkasapirinlumakadvideostinakasansiyentosbestidanagtalunannag-aabangdagligedurascontent,binatiretirarakalaresearch:hearpinakamatapatpaulapadabogorderinconditionmustnakaririmarimmarielserviceskuneanilahospitallanddayfiancebarnesmaramotluisumiiyaknecesariostep-by-steptiyakjeets-sorrypagkuwakalakihan