Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "mukah"

1. Tumingin siya saken at sa malungkot na mukah ay umiling.

Random Sentences

1. The United States has a system of government based on the principles of democracy and constitutionalism.

2. At ang hawak nitong bangos na tig-bebeinte.

3. The lightweight construction of the bicycle made it ideal for racing.

4. Danske møbler er kendt for deres høje kvalitet og eksporteres til mange lande.

5. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

6. Hindi na nga nakatindig si Aya at sa inis nito ay gumapang patungong hagdanan.

7. If you want to get the best deals at the farmer's market, you have to be the early bird.

8. May sisenta sentimos nang kumakalansing sa bulsa ng kutod niyang maong.

9. He has been building a treehouse for his kids.

10. Pumupunta ako sa Negros tuwing Abril.

11. Mathematics provides a universal language for communication between people of different cultures and backgrounds.

12. She donated a significant amount to a charitable organization for cancer research.

13. Mahalagang magkaroon ng budget plan upang maiwasan ang pagkakaroon ng utang.

14. Ano ang paborito mong pagkain?

15. The Hollywood Bowl is an iconic outdoor amphitheater that hosts concerts and live performances.

16. Hi Jace! Mukhang malakas na tayo ah! biro ko sa kanya.

17. Taon-taon ako pumupunta sa Pilipinas.

18. Las hojas del libro están todas marcadas con notas adhesivas.

19. Natutunan ng mga mag-aaral ang talambuhay ni Melchora Aquino bilang isang "Ina ng Himagsikan."

20. Isang beses naman ay ang sandok ang hinahanap.

21. Puno ng hinagpis ang liham na iniwan ni Clara bago siya tuluyang umalis.

22. Marami sa atin ang nababago ang pangarap sa buhay dahil sa mga karanasan.

23. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

24. Noong 2019, nanalo si Carlos Yulo ng gintong medalya sa World Artistic Gymnastics Championships.

25. Anong kulay ang gusto ni Andy?

26. Sa kabila ng kanyang tagumpay, nananatiling humble at grounded si Carlos Yulo.

27. The 10th Amendment of the Constitution outlines this division of power, stating that powers not delegated to the national government are reserved for the states

28. Maganda ang ginawang dekorasyon sa cake ni Abigael.

29. Gawin mo ang nararapat.

30. The bride usually wears a white wedding dress and the groom wears a suit or tuxedo.

31. Women have been celebrated for their contributions to culture, such as through literature, music, and art.

32. Malulungkot siya paginiwan niya ko.

33. Kumaripas si Ana papunta sa terminal para hindi maiwan ng bus.

34. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

35. "Love me, love my dog."

36. Users can create and customize their profile on Twitter, including a profile picture and bio.

37. Sang-ayon ako sa kagustuhan mo na magpatuloy sa iyong pag-aaral.

38. Oh ano 'to?! Sabi ko mansanas diba hindi saging!

39. Ahh Mommy, anong oras ba yung flight mo? tanong ni Maico.

40. Di pa namin napapag-usapan yan 'My.

41. It is important to have clear goals and expectations in the workplace.

42. Kung walang tiyaga, walang nilaga.

43. Pagod na ako at nagugutom siya.

44. The children are not playing outside.

45. Tsss. aniya. Kumunot pa ulit yung noo niya.

46. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

47. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

48. May masarap na mga pagkain sa buffet, pero mahaba ang pila para sa mga kubyertos.

49. Inalagaan niyang mabuti hanggang sa ito'y magbunga.

50. It ain't over till the fat lady sings

Recent Searches

mukahi-markpinaglagablabsayakamakailanbatang-bataeeeehhhhk-dramadulilumapitgrabekabutihanitinaobninumannag-oorasyonalexanderidaraanipaliniskumilosnaglalakadkababaihanmaulitnagbibigaysafertopictumayomatipunonapatawadpayapangpagsambasigusureroeffectslansanganhetolandlinecanteenipasokkaninangrepublicannowmagpakaramicinealamidreportkitdetteshiningalamnapaluhaumakyatfonopagmatalinobasketbolnagdiretsomeanayosfourtayotiyabilanginkantaiospagkainpalasyoistasyonbiglaanminabutinamilipiteconomicnathanmagattorneylagingkalayaanbagkus,bundokparehonghonestoinulitnangumbidaheldexperiencesjohnpresidentnawalanbagredigeringipinikitmapagkatiwalaanmag-aaralyayabutsanapinapagulongtuladbahabinge-watchingchadjaysonnag-away-awayoperahanhoneymoonersnapakalungkotpinalakingcomfortlinaschooldikyamnobodymagtigilnegativeawang-awalimitednag-umpisamahalpinagsulatdilawnagdaraankabangisanhulikaramihansintrapikpumitassayawanpagsisisinasaktanperfecttinapayiikotkabiyakonceaddresssmokingpakialamhahanapintigreikinabitabigaelmagbayaduniversityiniisipkalupipinag-usapanpaaralanawahumpaywonderslaslibongdibisyonditoinislabikinabibilanganradyomusmoshalamangkinuhalavkulaykasangkapanbuhayilagaynakuhaparakampanapaanokalalaroritopag-aaralangalasmariamenosticketlearnreplacedinisppaglalababobohabaentoncesagwadormonetizingprobinsyananonoodviolenceisubomaglalabacnicopaskongkayeleksyonpagtatanimhawlagrupobabaerosource