Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "merchandise"

1. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

Random Sentences

1. Nandoon lamang pala si Maria sa library.

2. Las rosas rojas son un regalo clásico para el Día de los Enamorados.

3. There are a lot of opportunities to learn and grow in life.

4. Mathematical formulas and equations are used to express relationships and patterns.

5. Tumawa rin siya ng malakas, How's Palawan? tanong niya.

6. Soto ayam adalah sup ayam yang dimasak dengan rempah-rempah Indonesia khas.

7. Nosotros nos disfrazamos y vamos a fiestas de Halloween durante las vacaciones.

8. Pede bang itanong kung anong oras na?

9. Nagpunta ako sa may kusina para hanapin siya.

10. Nagbigay siya ng magalang na pasasalamat sa tulong na ibinigay ng kanyang kaibigan.

11. Kumaripas ng takbo ang kabayo nang bumitaw ang sakay nitong tao.

12. Anung email address mo?

13. Lalong pinagsikapan ng paring Kastila ang pagtuturo ng buhay at mga aral ni HesuKristo.

14. Alt i alt er den danske økonomi kendt for sin høje grad af velstand og velfærd, og dette skyldes en kombination af markedsøkonomi og offentlig regulering, eksport, offentlig velfærd og økologisk bæredygtighed

15. The Great Pyramid of Giza is considered one of the Seven Wonders of the Ancient World.

16. Que tengas un buen viaje

17. Kailan niya ginagawa ang minatamis?

18. Bilang ganting langit sa mga kabutihan nina Waldo at Busyang, sila ay pinagkalooban ng isang anak na pagkaganda-ganda.

19. El actor hizo un comentario controversial que está llamando la atención de los medios.

20. Forgiveness doesn't mean forgetting or condoning the actions of others; it's about freeing ourselves from the negative emotions that hold us captive.

21. Algunas personas se dedican a crear arte como su profesión.

22. Madalas na may mga internasyonal na konferensya na ginaganap upang mapag-usapan ang mga usaping pangkapayapaan.

23. Sa komunikasyon, mahalaga ang wastong pag-unawa at pagtukoy sa mga hudyat upang magtagumpay ang pagpapahayag ng mensahe.

24. The stock market can provide opportunities for diversifying investment portfolios.

25. Effective use of emphasis can enhance the power and impact of communication.

26. It's never a good idea to let the cat out of the bag when it comes to confidential information - it can have serious consequences.

27. The elderly man was happy sitting on his porch, watching the world go by - sometimes ignorance is bliss in old age.

28. The wedding reception is a celebration that usually follows the wedding ceremony.

29. Walang tutulong sa iyo kundi ang iyong pamilya.

30. Cate Blanchett is an acclaimed actress known for her performances in films such as "Blue Jasmine" and "Elizabeth."

31. Bawal kang mapagod.. papagalitan nila ako pag napagod ka..

32. Una conciencia pesada puede ser un signo de que necesitamos cambiar nuestra conducta.

33. The concept of money has been around for thousands of years and has evolved over time.

34. Naisip niya na mas maganda kung nag-iisa siya sa bukid.

35. Anong pangalan ng lugar na ito?

36. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

37. Ang pag-asa ay nagbibigay ng pag-asa sa mga taong nakakaranas ng mga krisis at mga suliranin sa buhay.

38. May bagong dokumentaryo na ginawa ukol kay Apolinario Mabini.

39. Mayoritas penduduk Indonesia memeluk agama Islam, yang merupakan agama mayoritas di negara ini.

40. The zoo houses a variety of animals, including lions, elephants, and giraffes.

41. Sa loob ng paaralan, ang ingay ng mga mag-aaral ay binulabog ang kasiyahan ng mga guro.

42. Despues de cosechar, deja que el maíz se seque al sol durante unos días antes de retirar las hojas y las espigas

43. Some people view money as a measure of success and achievement, while others prioritize other values.

44. Foreclosed properties may be in need of major repairs or renovations, which can be expensive and time-consuming.

45. Bumuga siya ng hangin saka tumingin saken.

46. The United States has a system of federalism, where power is divided between the national government and the individual states

47. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

48. Investors can invest in a variety of asset classes, such as stocks, bonds, real estate, and commodities.

49. I love to celebrate my birthday with family and friends.

50. Gumagawa ng cake si Bb. Echave.

Recent Searches

merchandisesisipainmagpalagomarunongasiadespuesbutiperwisyobakapatienceinspiremaghahandaganangmatamansapilitanglazadaracialulongmagta-trabahonegosyotenernilolokokasoydeletingsilyanakiniginiintaykahitkayakasakitambagcarmenadvancesitawwatermaidkarapatanmalikotmulighederhomesnicopulissetyembrematulungininterestsadoptedtresjosemuranggustokisapmatapostcardonlinegrinsguhitpanginoonkulogsciencereservationshort10thdamdaminnagkakatipun-tiponnag-aalalangmaipantawid-gutomnakakakuhachecksgasolinakuwartonagsunuranmagagandangnakumbinsikikitasimbahanpagpasensyahannangampanyanasiyahanexhaustionkumikilospagmamanehomiranagtataasnananaloarbejdsstyrkenakakamitlumuwasnangangalitpaciencianandayakasiyahanmasaksihanvaccinesnatatawanakakaanimnaaksidentehaponmasasabigospelpartsre-reviewmaibibigaymakakabalikmagbalikkinalalagyantumirakuryentenakakainawtoritadongvillagesiyudadiyamottig-bebeintelumusobsinehanmilyongmahuhulipakukuluantumatawad1920sliligawanpaalamparusahanmusictumingalasumalakaynilaosmagkabilangadvancementnaghihirapnagniningningniyokaninamasayanggatolhiramdisensyoumupoenglandprobinsyayamanbuwayadalawincoughingsongsdealnatigilanestiloshinabolbandatamistugongrowthangelakunwadiapermejobinatangmagigitingbinatakilawboholexpresanplagasasobingopalaynangitutolbestdyipipantaloppepehusonooupomakaratingfar-reachingsnatransmitidastradegamitinstarredrenombredoktororugaasulramdamgrewpitospentmarioawatododilimmaitimredesmegetbroadcastterminobinigay