Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "private"

1. Facebook allows users to send private messages, comment on posts, and engage in group discussions.

2. Facebook Messenger is a standalone messaging app that allows users to have private conversations with friends and contacts.

3. Grande married Dalton Gomez, a real estate agent, in May 2021 in a private ceremony.

4. Instagram also offers the option to send direct messages to other users, allowing for private conversations.

5. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

6. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

7. Tom Hanks is an Academy Award-winning actor known for his roles in movies like "Forrest Gump" and "Saving Private Ryan."

8. Twitter allows users to send direct messages (DMs) to each other for private conversations.

Random Sentences

1. Ang lugaw ay dumikit sa palayok at nasunog.

2. Medical technology has also advanced in the areas of surgery and therapeutics, such as in robotic surgery and gene therapy

3. Oh ano na? Hindi ka na sumagot?

4. Pagkatapos pumili ng lugar, dapat mong magsimula sa pamamagitan ng pagpapakalat ng compost o fertilizer sa lupa bago magsimula sa pagtatanim

5. Certains pays et juridictions ont des lois qui régulent le jeu pour protéger les joueurs et prévenir la criminalité.

6. Nandito ako umiibig sayo.

7. The Pyramids of Chichen Itza in Mexico are an impressive wonder of Mayan civilization.

8. Kumukulo na ang aking sikmura.

9. Det danske økonomisystem er kendt for sin høje grad af velstand og velfærd

10. Sa gitna ng kagubatan, narinig ang hinagpis ng mga hayop na nawalan ng tirahan dahil sa pagtotroso.

11. Nagiging emosyonal ang mga panahon sa kasal, tulad ng mga pananalita ng mga magulang at mga kaibigan.

12. Ang digmaan ay maaaring magdulot ng pagbabago sa pamamahala ng isang bansa.

13. We have been waiting for the train for an hour.

14. Hindi ko ho kayo sinasadya.

15. Las plantas proporcionan oxígeno y son esenciales para mantener el equilibrio ecológico.

16. The game is played with two teams of five players each.

17. This could be physical products that you source and ship yourself, or digital products like e-books or courses

18. Ang paglutas ng mga palaisipan ay nakakatulong sa pagpapalawak ng kaalaman at kakayahan sa pagpapasya.

19.

20. Te agradezco por estar siempre ahí para mí.

21. Wer den Schaden hat, braucht für den Spott nicht zu sorgen.

22. Sadyang masarap ang lutong ng tinapay na ito.

23. Bis später! - See you later!

24. Det er vigtigt at have gode handelsrelationer med andre lande, hvis man ønsker at eksportere succesfuldt.

25. Electric cars can have positive impacts on the economy by creating jobs in the manufacturing, charging, and servicing industries.

26. He has been working on the computer for hours.

27. Investing in the stock market can be a form of passive income and a way to grow wealth over time.

28. Omelettes are a popular choice for those following a low-carb or high-protein diet.

29. Da Vinci fue un artista renacentista muy importante.

30. Dalam menghadapi tantangan, penting untuk memiliki dukungan sosial dan lingkungan yang positif.

31. Ang tindahan ay nasara dahil sa paulit-ulit na pag-suway sa business regulations.

32. Ang kelangan mo na lang gawin ay mag dasal..

33. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

34. Ignorieren wir unser Gewissen, kann dies zu einem Verlust unseres moralischen Kompasses führen.

35. Maaaring magkaroon ng interest at late fees kapag hindi nabayaran ang utang sa tamang panahon.

36. Nahahalinhan ng takot at lungkot nang kumulog at kumidlat.

37. Las redes sociales pueden ser una fuente de entretenimiento y diversión.

38. Captain Marvel possesses cosmic powers and is one of the most powerful superheroes in the Marvel Universe.

39. Los sueños son una forma de imaginar lo que podemos ser y hacer en la vida. (Dreams are a way of imagining what we can be and do in life.)

40. Nagmumukha siyang Intsik-beho kapag suot iyon ngunit wala naman siyang maraming kamisetang maisusuot.

41. Napakalakas ng kanyang halinghing dahil sa sobrang kalungkutan.

42. Claro que entiendo tu punto de vista.

43. Dahil sa pagkahapo ay nahiga siya sa lilim ng punung-kahoy para magpahinga.

44. He is not having a conversation with his friend now.

45. Inflation kann auch durch eine Erhöhung der Nachfrage nach bestimmten Waren und Dienstleistungen verursacht werden.

46. Hinde naman ako galit eh.

47. I like how the website has a blog section where users can read about various topics.

48. This can include correcting grammar and spelling errors, reorganizing sections, and adding or deleting information

49. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

50. Yumabong ang pagkakaisa ng mga tao sa panahon ng krisis.

Recent Searches

privatenananaloblessfullbathalacouldbabeorderdanceabsplatformsapelyidoandroidprogramslasingcuandosolidifyuponactivityreadtermdecreasednawalapagpanawbiologimarinigchartshistoriasnayonplanning,tipidagilafloorelepantetumatawadnakakatawapagka-maktolpagpapatubotinulak-tulaknangagsipagkantahanagwadormakapaibabawnalalabikahoynakatirangkinabubuhaykwenta-kwentat-shirtmagpaniwalapinaghihiwanapakatalinonagulatngingisi-ngisingpinakamatabangtinatawagpangungusappinabulaananglumakimedicinenakabawitumatawagnamataypinuntahanhouseholdspinamalagitumagalmiyerkulesnakalockkondisyonmagtagopaglulutoskyldes,lumibotbyggetsistemasbrancher,labinsiyambagkus,kristoperyahanperpektinghahahacountrynapakabilisnakabluenagbentanamumulanagbibirovaccinespagongtuyonilaostamarawkinakainkubyertoslabistagpiangproducerergawaingsinehanmagawanatanggappa-dayagonaltulangkunwasinungalingmonumentogrowthyoutubenapilitangtsinelasmagsaingjagiyabevareitutolcassandraalaalanagpalalimpepebansangmartespakealambuenaalamidstorobinhoodsusiambagtoretemedidaonlineremainpangingimijoemobilityaraw-arawleoputahetelevisedplanechaveevilneedscornerdamdaminlovepaghihirapayawmalumbaymabutirenombrebuhokpapagalitanworkshopcompositoreshospitalmanilbihanbasahantechnologicalbagneed,kanayangdevelopnakapikittelefonergeologi,sobrateleviewingnanatilibaranggaykumakalansingshadesmundopagsasalitaespecializadasthanksgivingilandragonyoungpaglakipuntahanpinipilitlolamaya-mayagumandaaguanapadefinitivomagpalagonakinigwifipartytomardoktordreamworksuotadvancedcigaretteslangosta