Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "private"

1. Facebook allows users to send private messages, comment on posts, and engage in group discussions.

2. Facebook Messenger is a standalone messaging app that allows users to have private conversations with friends and contacts.

3. Grande married Dalton Gomez, a real estate agent, in May 2021 in a private ceremony.

4. Instagram also offers the option to send direct messages to other users, allowing for private conversations.

5. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

6. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

7. Tom Hanks is an Academy Award-winning actor known for his roles in movies like "Forrest Gump" and "Saving Private Ryan."

8. Twitter allows users to send direct messages (DMs) to each other for private conversations.

Random Sentences

1. Sa tapat ng tarangkahan, may malalaking bulaklak na de-korasyon.

2. Hoy bakit, bakit dyan ka matutulog?

3. Nagka-bungang-araw si Baby dahil sa sobrang init.

4. The credit union provides better interest rates compared to traditional banks.

5.

6. Magtiis ka dyan sa pinili mong trabaho.

7. Medical technology has also advanced in the areas of surgery and therapeutics, such as in robotic surgery and gene therapy

8. Pero sa isang kondisyon, kailangang bayaran mo.

9. Mas pinapaboran ko ang pulotgata kaysa sa kendi kapag gusto ko ng matamis na panghimagas.

10. Bumoto ka nang ayon sa idinidikta ng iyong puso.

11. Nagpunta sa kumbento si Sister Jane.

12. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

13. The momentum of the rocket propelled it into space.

14. May mga taong nakakaramdam ng kalungkutan at nangangailangan ng pagtitiyaga at pang-unawa kapag sila ay mangiyak-ngiyak.

15. Ada banyak kitab suci yang berisi doa-doa, seperti Al-Qur'an, Injil, dan Weda.

16. Hindi dapat magbigay ng halaga sa mga kababawang bagay tulad ng kasikatan o kasikatan ng mga gamit.

17. Los días soleados de invierno pueden ser fríos pero hermosos, con un cielo azul brillante.

18. Claro, haré todo lo posible por resolver el problema.

19. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

20. Cybersecurity measures were implemented to prevent malicious traffic from affecting the network.

21. Hindi ko kayang magpanggap dahil ayokong maging isang taong nagpaplastikan.

22. Maraming hindi sumunod sa health protocols, samakatuwid, mabilis kumalat ang sakit.

23. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

24. Elektronisk udstyr kan hjælpe med at reducere energiforbrug og spare penge.

25. La labradora de mi primo es muy protectora de la familia y siempre está alerta.

26. Sumaya ang mundo ni kuya dahil sa iyo.

27. Trump's foreign policy approach included renegotiating international agreements, such as the North American Free Trade Agreement (NAFTA) and the Paris Agreement on climate change.

28. Mahirap magsalita nang diretsahan, pero sana pwede ba kitang mahalin?

29. Kehidupan penuh dengan tantangan yang harus dihadapi setiap orang.

30. Many schools and universities now use television as a way to provide distance learning

31. Malungkot ang lahat ng tao rito.

32. Meskipun tantangan hidup kadang-kadang sulit, tetapi mereka juga dapat memberikan kepuasan dan kebahagiaan ketika berhasil diatasi.

33. Ginagamit ang salitang "umano" upang ipahiwatig na ang isang pahayag ay hindi pa tiyak at batay lamang sa sinasabing impormasyon mula sa ibang tao o ulat

34. Wala akong pakelam. Respect nyo mukha nyo.

35. Los remedios naturales, como el té de jengibre y la miel, también pueden ayudar a aliviar la tos.

36. Nanalo siya ng isang milyong dolyar sa lotto.

37. The bridge was closed, and therefore we had to take a detour.

38. Emphasis can be used to persuade and influence others.

39. Then the traveler in the dark

40. Nagbasa ako ng libro sa library.

41. Bumili ako ng blusa sa Liberty Mall

42. Nasabi ng binata na ang bunga ay katulad ng matandang madamot na dating nakatira sa lugar na iyon.

43. Ang pangamba ay kadalasang sanhi ng hindi pagtanggap sa mga hamon sa buhay.

44. Hindi maganda ang kanilang plano kaya ako ay tumututol dito.

45. There are different types of scissors, such as sewing scissors, kitchen scissors, and craft scissors, each designed for specific purposes.

46. Dogs can provide a sense of security and protection to their owners.

47. Malapit na matapos ang kanyang termino sa pagka senador.

48. El control de las porciones es importante para mantener una dieta saludable.

49.

50. Isa kang hampaslupa! saad ng matapobreng babae.

Recent Searches

privatethroughoutballbringingcomputereumarawlabananchefnaggingfurthernagliliwanagpagnanasabranchcornerstopichjemstedinformedamountedit:ryanreadandybinuksanlimitmangemalinis4thmagta-trabahopinagmamalakiinabutannakainmahinangjuegospaghaliknagniningninghawaiiilanbeennagdabogpadabogibinaonbankhinamakbadingmassachusettsnababalot1929extrahimigpinakamagalingikinasasabiknakakapagpatibayculturamagkikitagodopoawtoritadongforskel,pakakatandaanmagtataasromanticismotumagalpagkatakotmorningpamilihang-bayanitokapagnapapatungomanlalakbaymagasawangpaghalakhakkikitanaguguluhangnagkapilatpaki-translatenakikianaguguluhanpinag-aaralansasamahanrevolutionerettagtuyottaun-taonpupuntahanshutipinatawagpakikipaglabanmagtagonailigtasprimeroskamandaggawinnangyarinakapagproposemasaktanskirttemperaturahouseholdnaghilamostumamisharapannakasakaypinagbubuksanlumusoblungsodtinatanongnabiawangcompaniestelebisyongawainkangitanganyanipapaputolumiilingpapayakinakainamuyinnasunogattorneybilibidlever,bintanapromisefollowingsunud-sunodpagmasdanbahagyangtaksieksport,kassingulanggotsimulamariloubayangisipaninnovationkubomarielvegasnakabiladalakmatitigasdiseasemanilasakimpondobundokipinanganaksinumanasomatipunoilocosiconicangkanpatunayansalitangginaganoonmalihisboholhealthlaryngitispunsomalayangbasahinkasomournedpangitdiagnosescommunitybinibinibusyangneatonightmanuscriptgearsuffercoaching:tryghedotraslimosnatingalasourcesoveralldinalawcommunicationcountriespalaginginalisreferspulaabstainingconventionalmagdugtongwhilewayspollutionthereforetopic,devicesenforcingdone