Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "angkan"

1. Ang aming angkan ay kilala sa aming lugar dahil sa aming mga tradisyon.

2. Ang aming angkan ay may malaking bahagi ng kasaysayan ng aming bayan.

3. Ang aming angkan ay may natatanging kultura at mga paniniwala.

4. Ang aming angkan ay mayroong mga natatanging tula at awitin.

5. Ang aming angkan ay mayroong mga tradisyon sa pagdiriwang ng mga okasyon.

6. Ang aming angkan ay mayroong natatanging uri ng pagluluto.

7. Ang aming angkan ay nagpapahalaga sa pagiging matapat sa mga relasyon.

8. Ang aming angkan ay nagpapahalaga sa tradisyong pamilya.

9. Ang mga kasapi ng aming angkan ay nagkakaisa sa pagtatrabaho para sa kinabukasan ng pamilya.

10. Lahat sila ay angkan ng matatalino.

11. Mahalaga sa aming angkan ang pagpapakita ng respeto sa nakatatanda.

12. Nagkakaisa ang aming angkan sa pagpapahalaga sa edukasyon.

13. Parehas na galing sa angkan ng mga mahuhusay humabi ang mag-asawa.

14. Si Bereti ay mula sa angkan na may maalwang buhay.

15. Sila ang unang angkan ng mga aso sa daigdig.

Random Sentences

1. Ayos lang ako. Ipapahinga ko lang ito.

2. Mahalagang magbigay ng respeto sa bawat isa, datapapwat ay hindi naman lahat ng tao ay magkakatugma ang mga paniniwala.

3. Ang mga batas tungkol sa paggamit ng droga ay mahalaga upang maiwasan ang mga krimen na may kinalaman sa droga.

4. Drinking enough water is essential for healthy eating.

5. Las hojas de mi cuaderno están llenas de garabatos y notas.

6. The authorities were stumped as to who the culprit could be in the unsolved case.

7. Quiero ser una influencia positiva en la vida de las personas que me rodean. (I want to be a positive influence in the lives of people around me.)

8. Sa dapit-hapon, masarap mag-picnic kasama ang pamilya at kaibigan.

9. Ang ganda na nang bagong Manila zoo.

10. Napatingin ako sa orasan. 12 na ng madaling araw.

11. Nasabi ng binata na ang bunga ay katulad ng matandang madamot na dating nakatira sa lugar na iyon.

12. Pakain na ako nang may dumating na bisita.

13. Sarado ang eskuwela sa Sabado at Linggo.

14. Rektanggulo ang hugis ng mesa namin.

15. Musk's innovations have transformed industries such as aerospace, automotive, and transportation.

16. Nagsisilbi siya bilang social worker upang matulungan ang mga taong nangangailangan ng tulong.

17. Kumain sa canteen ang mga estudyante.

18. La science des matériaux est utilisée dans la fabrication de nombreux produits de la vie quotidienne.

19. Pagkat ikaw ay bata at wala pang nalalaman.

20. Dahil sa globalisasyon, lubos na umangat ang teknolohiya ng maraming bansa.

21. Napakababa ng respeto ko sa mga taong laging mangiyak-ngiyak para lang mapansin.

22. Isa sa kanyang kasamahan sa bilangguan ay si Tony

23. Sa pamamagitan ng bayanihan, nagkaroon kami ng pag-aayos ng mga kalsada sa aming lugar.

24. She has learned to play the guitar.

25. Hockey is played with two teams of six players each, with one player designated as the goaltender.

26. Sige, tatawag na lang ako mamaya pag pauwi na ko..

27. Pasensya naman, anak rubber shoes ako eh.

28. Hindi ko malilimutan ang pagkanta namin ng "Hindi Kita Malilimutan" ng Bukas Palad sa aking graduation.

29. Ang mga punong-kahoy ay kinikilala rin bilang mga tagapagligtas ng ating planeta dahil sa kanilang kakayahan sa pag-absorb ng carbon dioxide.

30. Kaya't iyon ang naging dahilan kung bakit kinamumuhian niya ang kanayang ama at itinuring na patay na ito

31. The guilty verdict was handed down to the culprit in the embezzlement trial.

32. Ang mga engineer nagsisilbi upang mag-disenyo at magtayo ng mga imprastraktura para sa publiko.

33. Cutting corners might save time now, but it will cause problems down the line.

34. Maarte siya sa mga hotel na tinutuluyan kaya hindi siya nakikipagtipon sa mga backpacker's inn.

35. La tos puede ser un síntoma de cáncer de pulmón.

36. Sa bata nakatingin ang pulis na wari'y nag-iisip ng dapat gawin.

37. The cutting of the wedding cake is a traditional part of the reception.

38. In the early days, telephones were connected to a central switchboard, which connected calls manually

39. Ano ang ginagawa mo nang nagkasunog?

40. Mathematical concepts, such as geometry and calculus, are used in many everyday activities.

41. Madalas na may agam-agam sa buhay ng mga estudyante tuwing magkakaroon ng exam o project submission.

42. Ang pagsunod sa batas at regulasyon ay isang paraan ng pagpapakita ng paggalang at pag-itinuring sa sistema ng hustisya.

43. Les travailleurs peuvent être contraints de travailler à distance en raison de la pandémie COVID-19.

44. She admires the philanthropy work of the famous billionaire.

45. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

46. Kanino makikipaglaro si Marilou?

47. Ang nagtutulungan, nagtatagumpay.

48. This allows students to take classes from anywhere, and it also allows for the creation of specialized programs and courses that would not be possible in a traditional classroom setting

49. Gumising ka na. Mataas na ang araw.

50. Aku sangat sayang dengan kakek dan nenekku. (I deeply love my grandparents.)

Similar Words

bangkangtinangkang

Recent Searches

angkanmukhaakinporlinggo-linggosumalakayumaapawibabawmakapaniwalapinagkakaabalahanisinaramalumbaybalotisamalansanganmakatiyakglobalisasyonhamakbasketballsuspaanohubadmabigyanilongculturasinteractpopulationnaghuhumindigpadabogmagtatanimeskuwelanagpanggapbinyagangpangsalapondonagsisilbiputahebahagyanayonguronatatakotnararamdamanpasukankabiyakmakinanglindolkinuskosmalamannalalamansabilangitmakakibotingkumakantananahimikeyatotoongbatokayonaksiyonnilimaslucypakiramdambilibanyotaosnalakininongkoronakuryentepangalanbasuratungkoltinanggapbanalcultivoatensyonkasaysayanhinanaplumutanghumihingigawaingkagipitanbayangmaruminataposmaninipissinghaldali-dalimag-isangmaghintaylamanglalakipagraranaskailannatulalakaniladoonpoliticsmarangyangmanggadalandanpagkakamalibetamagkababataikawnaubosrinngunitdapit-haponnagingsimulamagdaraosayanregalopagluluksaikinamataypagtataposlupalopiyongcandidatesdadalhinginangbasketganidkatagapangkatpayongpag-isipanmalalimsamang-paladmakalawabitbitlikuranbabasugatanpangakomagandapagkatabing-dagatdesisyonanlungkotkahitlumisanallergydiningano-anolabananpasyapagkaingripogamotnakakulongkapagnasiradatapwatpalakanag-iisamasayang-masayasegundotamaexitdaganatatanawniyogkahariankaninumanbabasahingulatsamakatuwidninanaisbalanggloriahospitalultimatelyutakalingsamantalanginventedkaninamangingibigbakaoktubremababawtubig-ulanmatalinoeskwelahanprogrammingkansermahihirapmahusaypalamutieksenamediantepusoboxginamitmagturomanipis