Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "rolled"

1. As the eggs cook, they are gently folded and flipped to create a folded or rolled shape.

2. Cigarettes made of tobacco rolled in tissue paper helped spread a very harmful habit among the so-called advanced countries of the West

Random Sentences

1. Iyong pakakatandaan na ikaw lamang ang aking iniibig.

2. Pasensiya na kayo, wala po akong relo.

3. Danske virksomheder, der eksporterer varer til Kina, har haft stor succes på det kinesiske marked.

4. Mahal ko iyong dinggin.

5. Ang mahal naman ng laptop na binili ni Andy.

6. Electric cars can help reduce dependence on foreign oil and promote energy independence.

7. Naiinis na talaga ako. Kelangan ko ng tulog.

8. Sa harap ng tore, natatanaw ko ang ganda ng arkitektura at kahalagahan ng kasaysayan.

9. Money can take many forms, including cash, bank deposits, and digital currencies.

10. Omelettes are a popular choice for those following a low-carb or high-protein diet.

11. Nakatingin siya sa labas ng bintana, waring may hinihintay.

12. Det kan være en rejse at blive kvinde, hvor man lærer sig selv og verden bedre at kende.

13. In some cultures, the role of a wife is seen as subservient to her husband, but this is increasingly changing in modern times.

14. Nagtapos sya sa unibersidad ng Pilipinas.

15. Her music career took off with her debut album Yours Truly in 2013, featuring the hit single "The Way."

16. Da Vinci estuvo interesado en la anatomía y realizó numerosos estudios sobre el cuerpo humano.

17. En invierno, se pueden ver hermosos paisajes cubiertos de nieve y montañas nevadas.

18. Nous avons besoin de plus de lait pour faire cette recette.

19. Isang Saglit lang po.

20. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

21. Ang pangalan ng tatay ko ay Honesto.

22. Sa pagguhit, mahalaga ang tamang pagbigay ng shadows at highlights upang makalikha ng dimensyon sa isang drawing.

23. The experience of bungee jumping was both terrifying and euphoric.

24. Tinanong niya ang mga kapitbahay kung nakita nila ang kanyang anak.

25. She enjoys cooking a variety of dishes from different cultures.

26. The company's losses were due to the actions of a culprit who had been stealing supplies.

27. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

28. Magandang Gabi!

29. Les banques jouent un rôle clé dans la gestion de l'argent.

30. They go to the library to borrow books.

31. Después de haber viajado por todo el mundo, regresé a mi ciudad natal.

32. Nagdala ako ng mga bagong libro sa silid-aralan upang makapagbahagi sa mga kaklase.

33. Humingi siya ng makakain.

34. However, the quality of the data used to train AI algorithms is crucial, as biased or incomplete data can lead to inaccurate predictions and decisions.

35. Jeg er i gang med at skynde mig at få alt færdigt til mødet. (I'm in a hurry to finish everything for the meeting.)

36. Pakibigay sa driver ang bayad ko sa pamasahe, wala akong abot.

37. The United States is known for its entertainment industry, including Hollywood movies and Broadway shows.

38. Halos gawin na siyang prinsesa ng mga ito.

39. Kaninong payong ang dilaw na payong?

40. Ang puting pusa ang nasa sala.

41. Ang paghahanap ng katarungan at pagkamit ng hustisya ay nagpapawi ng galit at pagkadismaya.

42. Las escuelas ofrecen diferentes planes de estudios, dependiendo del nivel y la especialización.

43. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

44.

45. Me gusta mucho dibujar y pintar como pasatiempo.

46. Las drogas pueden alterar el estado de ánimo y la percepción de la realidad.

47. Matayog ang lipad ng saranggola ni Pepe.

48. Sadyang masarap ang lutong ng tinapay na ito.

49. Ang pag-asa ay nagbibigay ng kahulugan sa buhay ng mga tao sa pamamagitan ng kanilang mga pangarap at mga layunin.

50. Ang kanilang panaghoy ay tinugunan ng tulong mula sa mga taong may mabubuting puso.

Similar Words

Controlled

Recent Searches

rollednakapilangnabuhaynapakabilismagsisimulasuzettemagtakaumagawprimerospalibhasanamataynakikitangpaki-drawingsharmainemagkaibanguugud-ugodsong-writingmagpalibremensajesnaglalakadnagbakasyongobernadorchristmasnagtatampomadilimwalkie-talkienag-poutmakasilongtaun-taonnakuhangnagliwanaghinihintaybeautifulnaawarewardinghalinglingisusuotminatamisafternoonunconventionalnakakapuntapangalananmakatimaskaramagtanimmaisipmatayogimbeskasishoppingsayamagsunogmatabangnetflixtibigproudpaldaumakyaticonicalaalalandeanywheretambayanpigingnamanreachiniwannunolandotrendangerousminu-minutosinapakebidensyanamuhaysamakatuwidnaririnignilinissumamadagaabalagamotmodernenviarexampleneedsayanthreepilingmereechavespecialgabi-gabinungteamconsiderarinalalayannutrientesrose1973jerrymarahilbutinhalehomesdireksyontayoeveningpamumunonaroonkanilanagtitindamakikitanag-aalaytupelokatutubomayakaptsssbatalanfatalalmacenarkinaumilinglimasawalapiskubyertoskulunganmananaogsistemasmaidpalayanmahabolnyansamahantinanongtinaasanthoughtsjerometalentedtalagangtaglagastagaytaytagalabasumusunosumingitsumandalmakalaglag-pantysugatangstudentssquattersoftwareskyldes,kaparehasisipainbaosisidlansinundansinisirabansangsinipangsingsingsinampalsimplengsimbahansiksikanserviceskaloobangsawsawansasakyanikinabubuhaymagkaparehosandwichnaglalabasalitangsakalingsagasaansadyang,restawanreservesreplacedrenombrerelievedrelevantdiretsahangproducts:receptormaipagmamalakingrailwayspuntahanpumuslitpulitikofreelancing:providedproperlyprogramasingerproductspositibopoliticspinatira