Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "sampung"

1. Nanalo siya ng sampung libong piso.

2. Sampung minuto na lang bago mag-alas otso.

Random Sentences

1. May dalawang kotse sina Dolly at Joe.

2. Los padres experimentan un profundo vínculo emocional con su bebé desde el momento del nacimiento.

3. Dahil lumamang naman sa pagkakataong iyon ang mga mababangis na hayop, sa kanila lumapit si Paniki.

4. En invierno, los deportes en el hielo como el hockey sobre hielo y la patinaje sobre hielo son muy populares.

5. Nakasama umano sa listahan ng mga apektado ang ilang barangay sa lungsod.

6. Nagsmile si Athena tapos nag bow sa kanila.

7. Kawhi Leonard is known for his lockdown defense and has won multiple NBA championships.

8. Ang carbon dioxide ay inilalabas ng mga tao.

9. Ang malalakas na hiyaw ng galit at pagkadismaya ay binulabog ang kapayapaan ng pagtitipon.

10. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

11. Paano daw siya natalo ng isang matanda na mahina na ang mata at uugod-ugod pa.

12. The company used the acquired assets to upgrade its technology.

13. The teacher does not tolerate cheating.

14. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

15. I set my alarm for 5am every day because I truly believe the early bird gets the worm.

16.

17. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

18. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

19. Tumingala siya ngunit siya'y nasilaw.

20. Andrew Jackson, the seventh president of the United States, served from 1829 to 1837 and was known for his expansion of democracy and his controversial policies towards Native Americans.

21. Bawal magpakalat ng mga paninira sa kapwa dahil ito ay labag sa moralidad at etika.

22. Hinde ko alam kung bakit.

23. Alay ko sa iyo ang bawat sandali ng buhay ko.

24. Siya ang pangunahing lider ng Katipunan sa Cavite.

25. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

26. Make sure to keep track of your sources so that you can properly cite them in your book

27. Ang pambansang bayani ng Pilipinas ay si Jose Rizal.

28. Ang kaniyang galak ay animo'y nakakahawa, nagbibigay saya sa lahat ng nakapaligid.

29. Mabait sina Lito at kapatid niya.

30.

31. Heto po ang isang daang piso.

32. During the holidays, the family focused on charitable acts, like giving gifts to orphanages.

33. Maraming tao ang dumalo upang manood kung mananalo ang matanda sa batang si Amba.

34. Natapos ko ang aking trabaho sa opisina sa hatinggabi dahil marami akong backlog.

35. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

36. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

37. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

38. La santé est un état de bien-être physique, mental et social complet.

39. Los bebés recién nacidos tienen un olor dulce y tierno.

40. Scissors can have straight blades or curved blades, depending on the intended use.

41. Einstein was a member of the Institute for Advanced Study at Princeton University for many years.

42. Forgiving ourselves is equally important; we all make mistakes, and self-forgiveness is a vital step towards personal growth and self-acceptance.

43. Ganun talaga. Simpleng sagot ko.

44. Las heridas pueden ser causadas por cortes, abrasiones o quemaduras.

45. Penting untuk memiliki pola pikir yang fleksibel dan terbuka dalam menghadapi tantangan hidup.

46. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

47. Mataas sa calcium ang gatas at keso.

48. Sumama ka sa akin!

49. El powerbank es una solución conveniente para cargar teléfonos móviles, tabletas u otros dispositivos en movimiento.

50. Upang magawa ito, pinag-aralan niyang makapagsalita ng kanilang wika.

Recent Searches

sampunghiramtakottraditionalmassachusettscommercialbarabasmaistorboibonbilanggoawitinnababalotnagsisipag-uwianmasakitkulotsupilinmaaarigagandaibalikcentercriticsnababakasupworkgeneratemichaelchecksdebatesbackpag-aagwadorprogramming,generatedabstainingkagandahagmarketplaceskinikitakonsentrasyonnakatunghaymakapaibabawpoliticalnagmamaktolmedya-agwananghahapdipinagsikapannakapagngangalitpagpapakalatmagkikitaculturapaglakidoble-karamanghikayatmakikikainnakayukonagawanginvestingpumapaligidmahawaankonsultasyoninirapanmakalipaseconomylumiwagmagagandangdapit-haponkagandahannag-iisapinahalatapagkaimpaktopagpapasannalalabipagtataposclubkinauupuangmaihaharapkalayaanmagkaibakinagalitanmakakawawanaka-smirknapakahusaypanghabambuhaypagkakamalimakikiraananibersaryonanghihinanananaginiplumalakirepresentativesmaghahatidunattendedmaipagmamalakingmahahalikkusineroculturenagdiretsoinjurykalalaroutak-biyakumikilossinasadyamagagawanagkalapitpinuntahankabundukandeliciosatumagalpapuntangpahabolnahigitaniiwasanpaidmagkanogumuhitmabatongnakabibingingrektanggulonakalocktennistemperaturavideospaghuhugasmaintindihanhanapbuhaynag-emailincluirbwahahahahahapagkaangattagaytaymagtigilseguridadmagkasamatangeksmakasalanangpagkainislumakasactualidadtemparaturamedikaltinakasanmaliwanagpangangatawanmagpalagopagkabiglaforskel,pumitaskumainmagtanimnakapikittirangibabawnagpasanbarcelonagatolnagniningningunconstitutionalprotegidotiniklinghinilamaibalalokonsyertoligayapabilisuriinhalinglingmasayadireksyonnilaoskinakainunankamalianinhalevaliosapanginoonmahahawaiyamotpatakbongna-curiousnagwalispinabulaansiopaokapataganwriting,kamandagbroadcastshanmukhaebidensyarenaiakasaganaanngisikatagangnatigilansahodmaghatinggabilumbaydakilangasahanctricasunosmaestra